<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://cyana.org/w/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Miki</id>
	<title>CYANA Wiki - User contributions [en]</title>
	<link rel="self" type="application/atom+xml" href="https://cyana.org/w/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Miki"/>
	<link rel="alternate" type="text/html" href="https://cyana.org/wiki/Special:Contributions/Miki"/>
	<updated>2026-09-24T13:12:31Z</updated>
	<subtitle>User contributions</subtitle>
	<generator>MediaWiki 1.45.1</generator>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_garant&amp;diff=7679</id>
		<title>CYANA Macro: garant</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_garant&amp;diff=7679"/>
		<updated>2010-01-12T17:23:57Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Defined spectrum types */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; name=&#039;&#039;string&#039;&#039;: (default: $name or &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; runs=&#039;&#039;integer&#039;&#039;: (default: 1)&lt;br /&gt;
; sequence=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; dref=&#039;&#039;real&#039;&#039;: (default: 4.0)&lt;br /&gt;
; accuracy_H=&#039;&#039;real&#039;&#039;: (default: $max(tolerance(1),tolerance(2)))&lt;br /&gt;
; accuracy_N=&#039;&#039;real&#039;&#039;: (default: $tolerance(3))&lt;br /&gt;
; accuracy_C=&#039;&#039;real&#039;&#039;: (default: $tolerance(3))&lt;br /&gt;
; calibration=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; garant=&#039;&#039;string&#039;&#039;: (default: garant)&lt;br /&gt;
; assign=&#039;&#039;string&#039;&#039;: (default: assign)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs automated resonance assignment using the external program GARANT (Bartels et al., 1996; Bartels et al., 1997). Multiple &#039;&#039;runs&#039;&#039; of the program Garant with identical input data but different random number generator seed values can be executed. The input peak lists must have the name of the corresponding spectrum types:&lt;br /&gt;
                                                      &lt;br /&gt;
 COSY      homonuclear COSY&lt;br /&gt;
 TOCSY     homonuclear TOCSY&lt;br /&gt;
 NOESY     homonuclear NOESY&lt;br /&gt;
 D2OCOSY   homonuclear COSY in D&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&lt;br /&gt;
 D2OTOCSY  homonuclear TOCSY in D&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&lt;br /&gt;
 D2ONOESY  homonuclear NOESY in D&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&lt;br /&gt;
 C13H1     [&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-COSY	&lt;br /&gt;
 N15H1     [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-COSY	&lt;br /&gt;
 N15TOCSY  3D &amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-TOCSY&lt;br /&gt;
 RELTOCSY  2D &amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-TOCSY	&lt;br /&gt;
 N15NOESY  3D &amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 C13NOESY  3D &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 C13NOED2O 3D &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 CCNOESY   4D [&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 CNNOESY   4D [&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N]-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 NNNOESY   4D [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N]-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 HNHB      heteronuclear HNHB experiment&lt;br /&gt;
 HNHA      heteronuclear HNHA experiment&lt;br /&gt;
 HCCH24    HCCH-TOCSY&lt;br /&gt;
 HCCH7     HCCH-COSY&lt;br /&gt;
 CCH       CCH-TOCSY &lt;br /&gt;
 H_CA_NH   heteronuclear H(CA)NH experiment&lt;br /&gt;
 HNCA      heteronuclear HNCA experiment&lt;br /&gt;
 HN_CO_CA  heteronuclear HN(CO)CA experiment&lt;br /&gt;
 HN_CA_CO  heteronuclear HN(CA)CO experiment&lt;br /&gt;
 HNCO      heteronuclear HNCO experiment&lt;br /&gt;
 HCACO     heteronuclear H(CA)CO experiment&lt;br /&gt;
 HCA_CO_N  heteronuclear H(CA)CON experiment&lt;br /&gt;
 CBCANH    heteronuclear CBCANH experiment&lt;br /&gt;
 CBCACONH  heteronuclear CBCA(CO)NH experiment&lt;br /&gt;
 HBHACONH  heteronuclear HBHA(CO)NH experiment&lt;br /&gt;
 C_CO_NH   C(CCO)NH experiment&lt;br /&gt;
 HC_CO_NH  H(CCO)NH experiment&lt;br /&gt;
 HBCBCGHE  HBCBCGHE experiment for SAIL aromatics (Torizawa et al., 2005)&lt;br /&gt;
 CBCGHE    CBCGHE experiment for SAIL aromatics (Torizawa et al., 2005)&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7678</id>
		<title>CYANA Macro: overview</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7678"/>
		<updated>2010-01-12T17:19:25Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ovw: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; structures=&#039;&#039;integer&#039;&#039;: (default: 0)&lt;br /&gt;
; range=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;none&#039;&#039;)&lt;br /&gt;
; reference=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; significant=&#039;&#039;integer&#039;&#039;: (default: -1)&lt;br /&gt;
; hbond=&#039;&#039;integer&#039;&#039;: (default: -1)&lt;br /&gt;
; mode=sum|average|rms: (default: rms)&lt;br /&gt;
; ang&lt;br /&gt;
; cor&lt;br /&gt;
; pdb&lt;br /&gt;
; mean&lt;br /&gt;
; details&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Sorts the selected structures with regard to their target function value and creates an overview file called &#039;&#039;filename&#039;&#039;.ovw for the first n of these structures. If the &#039;&#039;&#039;file&#039;&#039;&#039; parameter is not specified and if a variable with name &#039;&#039;filename&#039;&#039; is defined, then its value is used as name. Pair-wise RMSDs are calculated for the given residue range (see command &#039;&#039;&#039;rmsd&#039;&#039;&#039;). The RMSD calculation can be suppressed by setting range=-. If the &#039;&#039;&#039;range&#039;&#039;&#039; parameter is not specified and if a variable with name rmsdrange is defined, then its value is used as residue range.  Optionally, output angle (ang), DG coordinate (cor) or PDB coordinate (pdb) files of the structures may be written with file names &amp;quot;name.ang&amp;quot;, &amp;quot;name.cor&amp;quot; or &amp;quot;name.pdb&amp;quot;, respectively.  The structures may be analyzed for hydrogen bonds (option &#039;&#039;&#039;hbond&#039;&#039;&#039;), or for violations of steric lower distance limits (option &#039;&#039;&#039;vdw&#039;&#039;&#039;).&lt;br /&gt;
Note: Because the target function is re-calculated, it is important that all restraints used for the calculation of the structures are present and that the same weights are used.  An overview file may contain four different tables:&lt;br /&gt;
For each structure: the target function value, the numbers, sums and maxima of restraint violations (the output of the structure list command).&lt;br /&gt;
For each violated restraint: the structures in which it is violated by more than the corresponding cutoff value (the output of the structure violate command). By default, violations are shown only if they occur in at least one third of the conformers. To obtain a listing of all violations larger than the cutoffs, the option full must be set.&lt;br /&gt;
For all pairs of structures: the RMSD for the backbone and all heavy atoms (output of the &#039;&#039;&#039;rmsd&#039;&#039;&#039; command). By default only the average value of all pairwise comparisons is written. A table with the individual pairwise RMSD values is created only if the option full is set.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Summarizes the results of a structure calculation. The summary is either stored in an overview file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;ovw&#039;&#039;&#039;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &#039;&#039;structures&#039;&#039; with the lowest target function values are analyzed and, if one or several of the options &#039;&#039;&#039;ang, cor&#039;&#039;&#039; or &#039;&#039;&#039;pdb&#039;&#039;&#039; are given, saved in an angle file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;ang&#039;&#039;&#039;, a DG format coordinate file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;cor&#039;&#039;&#039;, or a PDB coordinate file, &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;pdb&#039;&#039;&#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;br /&gt;
The summary starts with a table of the target function values and restraint violation statistics:&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
      Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals   torsion angles&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     0.20   1 0.0035  0.20   0    1.4  0.16   0 0.1205  1.22&lt;br /&gt;
      2     0.22   1 0.0036  0.19   0    1.5  0.17   0 0.1499  1.52&lt;br /&gt;
      3     0.22   2 0.0039  0.19   0    1.4  0.16   0 0.1597  1.64&lt;br /&gt;
      4     0.22   1 0.0032  0.18   0    1.5  0.16   0 0.1393  1.43&lt;br /&gt;
      5     0.22   1 0.0037  0.20   0    1.5  0.16   0 0.1751  1.79&lt;br /&gt;
      6     0.22   1 0.0036  0.19   0    1.6  0.16   0 0.1368  1.39&lt;br /&gt;
      7     0.22   2 0.0041  0.21   0    1.4  0.16   0 0.1730  1.79&lt;br /&gt;
      8     0.23   1 0.0034  0.18   0    1.6  0.16   0 0.1116  1.12&lt;br /&gt;
      9     0.24   1 0.0037  0.19   0    1.6  0.17   0 0.1647  1.69&lt;br /&gt;
     10     0.24   2 0.0039  0.18   0    1.6  0.16   0 0.1312  1.31&lt;br /&gt;
     11     0.24   2 0.0038  0.18   0    1.7  0.16   0 0.1127  1.13&lt;br /&gt;
     12     0.24   2 0.0041  0.18   0    1.6  0.16   0 0.1322  1.26&lt;br /&gt;
     13     0.25   2 0.0038  0.18   0    1.6  0.16   0 0.1475  1.49&lt;br /&gt;
     14     0.25   2 0.0042  0.21   0    1.6  0.17   0 0.1497  1.45&lt;br /&gt;
     15     0.25   1 0.0037  0.20   0    1.8  0.16   0 0.1287  1.25&lt;br /&gt;
     16     0.25   1 0.0033  0.18   0    1.8  0.16   0 0.1347  1.37&lt;br /&gt;
     17     0.26   1 0.0035  0.18   0    1.8  0.16   0 0.1568  1.57&lt;br /&gt;
     18     0.26   2 0.0039  0.19   0    1.8  0.16   0 0.1308  1.32&lt;br /&gt;
     19     0.26   1 0.0040  0.20   0    1.9  0.16   0 0.1240  1.22&lt;br /&gt;
     20     0.26   1 0.0033  0.18   0    1.7  0.16   0 0.1678  1.46&lt;br /&gt;
 &lt;br /&gt;
    Ave     0.24   1 0.0037  0.19   0    1.6  0.16   0 0.1423  1.42&lt;br /&gt;
    +/- 1.71E-02   0 0.0003  0.01   0    0.1  0.00   0 0.0188  0.20&lt;br /&gt;
    Min     0.20   1 0.0032  0.18   0    1.4  0.16   0 0.1116  1.12&lt;br /&gt;
    Max     0.26   2 0.0042  0.21   0    1.9  0.17   0 0.1751  1.79&lt;br /&gt;
    Cut                      0.10             0.20             5.00&lt;br /&gt;
&lt;br /&gt;
This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &#039;&#039;mode&#039;&#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;br /&gt;
Restraints that are violated in a &#039;&#039;significant&#039;&#039; number of structures by more than the corresponding cutoff value are reported:&lt;br /&gt;
&lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper H     PHE   64 - HB2   GLU   65   5.50  11   0.11   0.21  +++ ++* +    +++  +   peak 3766&lt;br /&gt;
    Upper H     PHE   64 - HB3   GLU   65   5.50   9   0.08   0.19     +   + ++++   +* +  peak 3766&lt;br /&gt;
    2 violated distance constraints.&lt;br /&gt;
    0 violated angle constraints.&lt;br /&gt;
&lt;br /&gt;
Each line identifies a violated restraint, and gives the number of structures in which the restraint is violated by more than the aforementioned cutoff value (column labeled “&#039;&#039;&#039;#&#039;&#039;&#039;”), its maximal violation (column “max.”), and the structures in which the violations occur (a one-character column for each structure that is analyzed). Structures in which the restraint is violated by more than the cutoff are marked with “&#039;&#039;&#039;+&#039;&#039;&#039;”, or with a “*” for the structure in which the maximal violation occurs. If available, the number of the cross peak from which the restraint originated is given at the end of the line. &lt;br /&gt;
A list of the hydrogen bonds that occur in more than &#039;&#039;hbond&#039;&#039; structures is given if requested by the &#039;&#039;&#039;hbond&#039;&#039;&#039; parameter:&lt;br /&gt;
    Hydrogen bonds:                   # 1   5   10   15   20&lt;br /&gt;
    H     LYS   23 - O     SER   19  20 ++++++++++++++++++++&lt;br /&gt;
    H     ARG   24 - O     TYR   20  19 ++++++++++++ +++++++&lt;br /&gt;
    HE21  GLN   25 - O     GLN   25  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   26 - O     GLU   22  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   28 - O     ARG   24  20 ++++++++++++++++++++&lt;br /&gt;
    H     ASN   31 - O     SER   27  20 ++++++++++++++++++++&lt;br /&gt;
    H     ARG   40 - O     LYS   37  15 +++ + +++++++  +++ +&lt;br /&gt;
    H     VAL   41 - O     LEU   38  20 ++++++++++++++++++++&lt;br /&gt;
    H     ILE   44 - O     VAL   41  18 ++++ ++++++++++ ++++&lt;br /&gt;
    H     ARG   48 - O     ILE   45  16 ++   ++++++++ ++++++&lt;br /&gt;
    HH21  ARG   48 - OG    SER   47  15 ++  + +++++ ++++ +++&lt;br /&gt;
    H     GLU   49 - O     ILE   45  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   52 - O     GLU   49  20 ++++++++++++++++++++&lt;br /&gt;
    H     LYS   53 - O     GLU   49  19 ++++++ +++++++++++++&lt;br /&gt;
    H     SER   55 - O     LYS   53  15 +++++ + ++++++ +  ++&lt;br /&gt;
    H     GLU   76 - O     LEU   72  20 ++++++++++++++++++++&lt;br /&gt;
    H     VAL   79 - O     LEU   75  17 ++++++++++++ + ++++&lt;br /&gt;
    H     THR   80 - O     GLU   76  20 ++++++++++++++++++++&lt;br /&gt;
    H     CYS   82 - O     TYR   78  15 +++++++++++ +  + ++&lt;br /&gt;
    H     LEU   83 - O     VAL   79  18 +++++ ++++++++++++ +&lt;br /&gt;
    20 hydrogen bonds. &lt;br /&gt;
&lt;br /&gt;
The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&#039;&#039;&#039;structures hbonds&#039;&#039;&#039;]] command is reported in the column labeled “&#039;&#039;&#039;#&#039;&#039;&#039;”, and the corresponding structures are identified by “&#039;&#039;&#039;+&#039;&#039;&#039;” signs. &lt;br /&gt;
At the end of the overview RMSD values for the given residue &#039;&#039;range&#039;&#039; are given:&lt;br /&gt;
    RMSDs for residues 15..84:&lt;br /&gt;
    Average backbone RMSD to mean   :    0.37 +/- 0.08 A (0.22..0.53 A; 20 structures)&lt;br /&gt;
    Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;br /&gt;
If the parameter &#039;&#039;&#039;range&#039;&#039;&#039; for residue range is absent, the range will be taken from the variable &#039;&#039;&#039;rmsdrange&#039;&#039;&#039;, if defined, or determined automatically by the [[CYANA Macro: overlay|&#039;&#039;&#039;overlay&#039;&#039;&#039;]] command otherwise. The RMSD calculation can be suppressed by setting &#039;&#039;&#039;range=–&#039;&#039;&#039;. The residue range used for the superposition is indicated, and RMSD values are computed for the backbone and heavy atoms with the [[CYANA Macro: rmsd|&#039;&#039;&#039;rmsd&#039;&#039;&#039;]] command. The average value, the standard deviation, and the minimal and maximal values of the RMSDs between the analyzed structures and their mean coordinates are calculated. &lt;br /&gt;
If a &#039;&#039;reference&#039;&#039; structure has been specified, then the RMSD values between the mean coordinates of the analyzed structures and the mean coordinates of the reference structure(s) are reported in two additional lines:&lt;br /&gt;
    RMSDs for residues 15..84:&lt;br /&gt;
    Average backbone RMSD to mean   :    0.37 +/- 0.08 A (0.22..0.53 A; 20 structures)&lt;br /&gt;
    Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;br /&gt;
    Backbone RMSD to reference      :    0.89 A (210 atoms)&lt;br /&gt;
    Heavy atom RMSD to reference    :    1.17 A (571 atoms)&lt;br /&gt;
The number of corresponding atoms that have been superimposed in the two structures to calculate the RMSD values to the reference structure are given in parenthesis. RMSD values are computed with the [[CYANA Macro: rmsd|&#039;&#039;&#039;rmsd&#039;&#039;&#039;]] command.&lt;br /&gt;
Additional output can be obtained by setting the option &#039;&#039;&#039;details&#039;&#039;&#039;. This includes first the consensus secondary structure determined by the DSSP algorithm (Kabsch &amp;amp; Sander, 1983), implemented in the command [[CYANA Command: structures secondary|&#039;&#039;&#039;structures secondary&#039;&#039;&#039;]]:&lt;br /&gt;
    Consensus secondary structure in 20 or more conformers:&lt;br /&gt;
               1   5   10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   85&lt;br /&gt;
    4-turn   :                   &amp;gt;&amp;gt;&amp;gt;&amp;gt;XXXXXX&amp;lt;&amp;lt;&amp;lt;&amp;lt; &amp;gt;44&amp;gt;X4&amp;gt;XX&amp;gt;&amp;lt;X&amp;lt;&amp;lt;4X444&amp;lt;  &amp;gt;444&amp;lt;  &amp;gt;444&amp;lt;&amp;gt;44&amp;gt;X&amp;gt;4XX&amp;lt;&amp;gt;X&amp;lt;4&amp;lt;&amp;lt;&lt;br /&gt;
    3-turn   :                        &amp;gt;33&amp;lt;         &amp;gt;33&amp;lt;    &amp;gt;33&amp;lt;&amp;gt;33&amp;lt;&lt;br /&gt;
    Summary  :                    HHHHHHHHHHHH      HHHHHHHHH                         HHHHHHHHHHH&lt;br /&gt;
    Sequence : GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRK&lt;br /&gt;
               1   5   10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   85&lt;br /&gt;
A list of the torsion angles with a “split” distribution of values, determined by the command [[CYANA Command: angles split|&#039;&#039;&#039;angles split&#039;&#039;&#039;]], follows: &lt;br /&gt;
    Split angles:    mean1  mean2    dev   # 1   5   10   15   20&lt;br /&gt;
    PSI   LYS   14   169.8  -61.6   11.0   4   +   +  +     +&lt;br /&gt;
    CHI1  CYS   15    51.6  -65.4    9.5  10  ++ +   +   + + ++++&lt;br /&gt;
    PSI   PRO   17   124.5  173.6    0.6   6  ++     +      +  ++&lt;br /&gt;
    PHI   MET   18   -87.4 -132.4    3.5   6  ++     +      +  ++&lt;br /&gt;
    CHI1  SER   19   -53.9 -168.9   11.6   8  ++      +++  ++   +&lt;br /&gt;
    CHI2  GLU   22   -75.8 -166.1    9.1   4        +  + +   +&lt;br /&gt;
    CHI2  LYS   32   -86.5 -176.9    3.7   2          +         +&lt;br /&gt;
    CHI1  GLU   36    60.4  169.0    3.3   4        +      + +  +&lt;br /&gt;
    CHI1  VAL   42    70.4 -174.5    2.6   7    + +  +   +++    +&lt;br /&gt;
    CHI3  GLN   46   -23.5   21.6    4.4   4      + +      +  +&lt;br /&gt;
    CHI2  ARG   48   -68.8 -124.9    3.2   1            +&lt;br /&gt;
    CHI1  LYS   53  -175.2   74.4    7.4   5 ++    ++     +&lt;br /&gt;
    PSI   LYS   53   -30.8  159.5    0.6   4      + +      +  +&lt;br /&gt;
    PHI   ASN   54   -89.1   62.6    2.1   4      + +      +  +&lt;br /&gt;
    CHI1  GLU   61   -74.7   59.2    9.7   7 + +  +  +   +  ++&lt;br /&gt;
    CHI1  GLU   65    83.2  -32.8    1.2   9        ++++ ++ + + +&lt;br /&gt;
    CHI1  THR   66    62.3 -175.9    8.8   9  + ++        + +++++&lt;br /&gt;
    CHI2  LYS   68   168.0   75.9   10.4   7          ++ ++   +++&lt;br /&gt;
    CHI1  ARG   73   -93.1 -159.1    8.2  10  ++  + +++    ++  ++&lt;br /&gt;
    CHI2  ARG   73   -67.3   64.2    3.7   8  ++  +  ++    +   ++&lt;br /&gt;
    CHI4  ARG   73  -179.8   76.8    9.1   6  ++    ++   +     +&lt;br /&gt;
    CHI1  SER   81   -77.2  171.3   11.2   9 + ++ + +  +++    +&lt;br /&gt;
    CHI1  CYS   82  -172.8  -78.5   11.7   9 +      ++  + + ++ ++&lt;br /&gt;
    PSI   LYS   88    71.3  159.9    1.4   6     ++ + +  +    +&lt;br /&gt;
    24 split dihedral angle distributions.&lt;br /&gt;
&lt;br /&gt;
These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.  &lt;br /&gt;
Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics are reported:&lt;br /&gt;
    Ramachandran plot outliers:&lt;br /&gt;
                  #  1   5   10   15   20&lt;br /&gt;
    LYS    88     1  ....* ... ....... ..&lt;br /&gt;
    Residues in most favored regions        :  89.1 %&lt;br /&gt;
    Residues in additionally allowed regions:  10.8 % (symbol: .)&lt;br /&gt;
    Residues in generously allowed regions  :   0.0 % (symbol: +)&lt;br /&gt;
    Residues in disallowed regions          :   0.1 % (symbol: *)&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7677</id>
		<title>CYANA Macro: overview</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7677"/>
		<updated>2010-01-12T16:54:08Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ovw: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; structures=&#039;&#039;integer&#039;&#039;: (default: 0)&lt;br /&gt;
; range=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;none&#039;&#039;)&lt;br /&gt;
; reference=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; significant=&#039;&#039;integer&#039;&#039;: (default: -1)&lt;br /&gt;
; hbond=&#039;&#039;integer&#039;&#039;: (default: -1)&lt;br /&gt;
; mode=sum|average|rms: (default: rms)&lt;br /&gt;
; ang&lt;br /&gt;
; cor&lt;br /&gt;
; pdb&lt;br /&gt;
; mean&lt;br /&gt;
; details&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Sorts the selected structures with regard to their target function value and creates an overview file name.ovw for the first n of these structures. If the name parameter is not specified and if a variable with name name is defined, then its value is used as name.  Pair-wise RMSDs are calculated for the given residue range (see command &#039;&#039;&#039;rmsd&#039;&#039;&#039;). The RMSD calculation can be suppressed by setting range=-. If the &#039;&#039;&#039;range&#039;&#039;&#039; parameter is not specified and if a variable with name rmsdrange is defined, then its value is used as residue range.  Optionally, output angle (ang), DG coordinate (cor) or PDB coordinate (pdb) files of the structures may be written with file names &amp;quot;name.ang&amp;quot;, &amp;quot;name.cor&amp;quot; or &amp;quot;name.pdb&amp;quot;, respectively.  The structures may be analyzed for hydrogen bonds (option &#039;&#039;&#039;hbond&#039;&#039;&#039;), or for violations of steric lower distance limits (option &#039;&#039;&#039;vdw&#039;&#039;&#039;).&lt;br /&gt;
Note: Because the target function is re-calculated, it is important that all restraints used for the calculation of the structures are present and that the same weights are used.  An overview file may contain four different tables:&lt;br /&gt;
For each structure: the target function value, the numbers, sums and maxima of restraint violations (the output of the structure list command).&lt;br /&gt;
For each violated restraint: the structures in which it is violated by more than the corresponding cutoff value (the output of the structure violate command). By default, violations are shown only if they occur in at least one third of the conformers. To obtain a listing of all violations larger than the cutoffs, the option full must be set.&lt;br /&gt;
For all pairs of structures: the RMSD for the backbone and all heavy atoms (output of the &#039;&#039;&#039;rmsd&#039;&#039;&#039; command). By default only the average value of all pairwise comparisons is written. A table with the individual pairwise RMSD values is created only if the option full is set.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Summarizes the results of a structure calculation. The summary is either stored in an overview file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;ovw&#039;&#039;&#039;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &#039;&#039;structures&#039;&#039; with the lowest target function values are analyzed and, if one or several of the options &#039;&#039;&#039;ang, cor&#039;&#039;&#039; or &#039;&#039;&#039;pdb&#039;&#039;&#039; are given, saved in an angle file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;ang&#039;&#039;&#039;, a DG format coordinate file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;cor&#039;&#039;&#039;, or a PDB coordinate file, &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;pdb&#039;&#039;&#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;br /&gt;
The summary starts with a table of the target function values and restraint violation statistics:&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
      Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals   torsion angles&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     0.20   1 0.0035  0.20   0    1.4  0.16   0 0.1205  1.22&lt;br /&gt;
      2     0.22   1 0.0036  0.19   0    1.5  0.17   0 0.1499  1.52&lt;br /&gt;
      3     0.22   2 0.0039  0.19   0    1.4  0.16   0 0.1597  1.64&lt;br /&gt;
      4     0.22   1 0.0032  0.18   0    1.5  0.16   0 0.1393  1.43&lt;br /&gt;
      5     0.22   1 0.0037  0.20   0    1.5  0.16   0 0.1751  1.79&lt;br /&gt;
      6     0.22   1 0.0036  0.19   0    1.6  0.16   0 0.1368  1.39&lt;br /&gt;
      7     0.22   2 0.0041  0.21   0    1.4  0.16   0 0.1730  1.79&lt;br /&gt;
      8     0.23   1 0.0034  0.18   0    1.6  0.16   0 0.1116  1.12&lt;br /&gt;
      9     0.24   1 0.0037  0.19   0    1.6  0.17   0 0.1647  1.69&lt;br /&gt;
     10     0.24   2 0.0039  0.18   0    1.6  0.16   0 0.1312  1.31&lt;br /&gt;
     11     0.24   2 0.0038  0.18   0    1.7  0.16   0 0.1127  1.13&lt;br /&gt;
     12     0.24   2 0.0041  0.18   0    1.6  0.16   0 0.1322  1.26&lt;br /&gt;
     13     0.25   2 0.0038  0.18   0    1.6  0.16   0 0.1475  1.49&lt;br /&gt;
     14     0.25   2 0.0042  0.21   0    1.6  0.17   0 0.1497  1.45&lt;br /&gt;
     15     0.25   1 0.0037  0.20   0    1.8  0.16   0 0.1287  1.25&lt;br /&gt;
     16     0.25   1 0.0033  0.18   0    1.8  0.16   0 0.1347  1.37&lt;br /&gt;
     17     0.26   1 0.0035  0.18   0    1.8  0.16   0 0.1568  1.57&lt;br /&gt;
     18     0.26   2 0.0039  0.19   0    1.8  0.16   0 0.1308  1.32&lt;br /&gt;
     19     0.26   1 0.0040  0.20   0    1.9  0.16   0 0.1240  1.22&lt;br /&gt;
     20     0.26   1 0.0033  0.18   0    1.7  0.16   0 0.1678  1.46&lt;br /&gt;
 &lt;br /&gt;
    Ave     0.24   1 0.0037  0.19   0    1.6  0.16   0 0.1423  1.42&lt;br /&gt;
    +/- 1.71E-02   0 0.0003  0.01   0    0.1  0.00   0 0.0188  0.20&lt;br /&gt;
    Min     0.20   1 0.0032  0.18   0    1.4  0.16   0 0.1116  1.12&lt;br /&gt;
    Max     0.26   2 0.0042  0.21   0    1.9  0.17   0 0.1751  1.79&lt;br /&gt;
    Cut                      0.10             0.20             5.00&lt;br /&gt;
&lt;br /&gt;
This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &#039;&#039;mode&#039;&#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;br /&gt;
Restraints that are violated in a &#039;&#039;significant&#039;&#039; number of structures by more than the corresponding cutoff value are reported:&lt;br /&gt;
&lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper H     PHE   64 - HB2   GLU   65   5.50  11   0.11   0.21  +++ ++* +    +++  +   peak 3766&lt;br /&gt;
    Upper H     PHE   64 - HB3   GLU   65   5.50   9   0.08   0.19     +   + ++++   +* +  peak 3766&lt;br /&gt;
    2 violated distance constraints.&lt;br /&gt;
    0 violated angle constraints.&lt;br /&gt;
&lt;br /&gt;
Each line identifies a violated restraint, and gives the number of structures in which the restraint is violated by more than the aforementioned cutoff value (column labeled “&#039;&#039;&#039;#&#039;&#039;&#039;”), its maximal violation (column “max.”), and the structures in which the violations occur (a one-character column for each structure that is analyzed). Structures in which the restraint is violated by more than the cutoff are marked with “&#039;&#039;&#039;+&#039;&#039;&#039;”, or with a “*” for the structure in which the maximal violation occurs. If available, the number of the cross peak from which the restraint originated is given at the end of the line. &lt;br /&gt;
A list of the hydrogen bonds that occur in more than &#039;&#039;hbond&#039;&#039; structures is given if requested by the &#039;&#039;&#039;hbond&#039;&#039;&#039; parameter:&lt;br /&gt;
    Hydrogen bonds:                   # 1   5   10   15   20&lt;br /&gt;
    H     LYS   23 - O     SER   19  20 ++++++++++++++++++++&lt;br /&gt;
    H     ARG   24 - O     TYR   20  19 ++++++++++++ +++++++&lt;br /&gt;
    HE21  GLN   25 - O     GLN   25  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   26 - O     GLU   22  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   28 - O     ARG   24  20 ++++++++++++++++++++&lt;br /&gt;
    H     ASN   31 - O     SER   27  20 ++++++++++++++++++++&lt;br /&gt;
    H     ARG   40 - O     LYS   37  15 +++ + +++++++  +++ +&lt;br /&gt;
    H     VAL   41 - O     LEU   38  20 ++++++++++++++++++++&lt;br /&gt;
    H     ILE   44 - O     VAL   41  18 ++++ ++++++++++ ++++&lt;br /&gt;
    H     ARG   48 - O     ILE   45  16 ++   ++++++++ ++++++&lt;br /&gt;
    HH21  ARG   48 - OG    SER   47  15 ++  + +++++ ++++ +++&lt;br /&gt;
    H     GLU   49 - O     ILE   45  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   52 - O     GLU   49  20 ++++++++++++++++++++&lt;br /&gt;
    H     LYS   53 - O     GLU   49  19 ++++++ +++++++++++++&lt;br /&gt;
    H     SER   55 - O     LYS   53  15 +++++ + ++++++ +  ++&lt;br /&gt;
    H     GLU   76 - O     LEU   72  20 ++++++++++++++++++++&lt;br /&gt;
    H     VAL   79 - O     LEU   75  17 ++++++++++++ + ++++&lt;br /&gt;
    H     THR   80 - O     GLU   76  20 ++++++++++++++++++++&lt;br /&gt;
    H     CYS   82 - O     TYR   78  15 +++++++++++ +  + ++&lt;br /&gt;
    H     LEU   83 - O     VAL   79  18 +++++ ++++++++++++ +&lt;br /&gt;
    20 hydrogen bonds. &lt;br /&gt;
&lt;br /&gt;
The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&#039;&#039;&#039;structures hbonds&#039;&#039;&#039;]] command is reported in the column labeled “&#039;&#039;&#039;#&#039;&#039;&#039;”, and the corresponding structures are identified by “&#039;&#039;&#039;+&#039;&#039;&#039;” signs. &lt;br /&gt;
At the end of the overview RMSD values for the given residue &#039;&#039;range&#039;&#039; are given:&lt;br /&gt;
    RMSDs for residues 15..84:&lt;br /&gt;
    Average backbone RMSD to mean   :    0.37 +/- 0.08 A (0.22..0.53 A; 20 structures)&lt;br /&gt;
    Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;br /&gt;
If the parameter &#039;&#039;&#039;range&#039;&#039;&#039; for residue range is absent, the range will be taken from the variable &#039;&#039;&#039;rmsdrange&#039;&#039;&#039;, if defined, or determined automatically by the [[CYANA Macro: overlay|&#039;&#039;&#039;overlay&#039;&#039;&#039;]] command otherwise. The RMSD calculation can be suppressed by setting &#039;&#039;&#039;range=–&#039;&#039;&#039;. The residue range used for the superposition is indicated, and RMSD values are computed for the backbone and heavy atoms with the [[CYANA Macro: rmsd|&#039;&#039;&#039;rmsd&#039;&#039;&#039;]] command. The average value, the standard deviation, and the minimal and maximal values of the RMSDs between the analyzed structures and their mean coordinates are calculated. &lt;br /&gt;
If a &#039;&#039;reference&#039;&#039; structure has been specified, then the RMSD values between the mean coordinates of the analyzed structures and the mean coordinates of the reference structure(s) are reported in two additional lines:&lt;br /&gt;
    RMSDs for residues 15..84:&lt;br /&gt;
    Average backbone RMSD to mean   :    0.37 +/- 0.08 A (0.22..0.53 A; 20 structures)&lt;br /&gt;
    Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;br /&gt;
    Backbone RMSD to reference      :    0.89 A (210 atoms)&lt;br /&gt;
    Heavy atom RMSD to reference    :    1.17 A (571 atoms)&lt;br /&gt;
The number of corresponding atoms that have been superimposed in the two structures to calculate the RMSD values to the reference structure are given in parenthesis. RMSD values are computed with the [[CYANA Macro: rmsd|&#039;&#039;&#039;rmsd&#039;&#039;&#039;]] command.&lt;br /&gt;
Additional output can be obtained by setting the option &#039;&#039;&#039;details&#039;&#039;&#039;. This includes first the consensus secondary structure determined by the DSSP algorithm (Kabsch &amp;amp; Sander, 1983), implemented in the command [[CYANA Command: structures secondary|&#039;&#039;&#039;structures secondary&#039;&#039;&#039;]]:&lt;br /&gt;
    Consensus secondary structure in 20 or more conformers:&lt;br /&gt;
               1   5   10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   85&lt;br /&gt;
    4-turn   :                   &amp;gt;&amp;gt;&amp;gt;&amp;gt;XXXXXX&amp;lt;&amp;lt;&amp;lt;&amp;lt; &amp;gt;44&amp;gt;X4&amp;gt;XX&amp;gt;&amp;lt;X&amp;lt;&amp;lt;4X444&amp;lt;  &amp;gt;444&amp;lt;  &amp;gt;444&amp;lt;&amp;gt;44&amp;gt;X&amp;gt;4XX&amp;lt;&amp;gt;X&amp;lt;4&amp;lt;&amp;lt;&lt;br /&gt;
    3-turn   :                        &amp;gt;33&amp;lt;         &amp;gt;33&amp;lt;    &amp;gt;33&amp;lt;&amp;gt;33&amp;lt;&lt;br /&gt;
    Summary  :                    HHHHHHHHHHHH      HHHHHHHHH                         HHHHHHHHHHH&lt;br /&gt;
    Sequence : GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRK&lt;br /&gt;
               1   5   10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   85&lt;br /&gt;
A list of the torsion angles with a “split” distribution of values, determined by the command [[CYANA Command: angles split|&#039;&#039;&#039;angles split&#039;&#039;&#039;]], follows: &lt;br /&gt;
    Split angles:    mean1  mean2    dev   # 1   5   10   15   20&lt;br /&gt;
    PSI   LYS   14   169.8  -61.6   11.0   4   +   +  +     +&lt;br /&gt;
    CHI1  CYS   15    51.6  -65.4    9.5  10  ++ +   +   + + ++++&lt;br /&gt;
    PSI   PRO   17   124.5  173.6    0.6   6  ++     +      +  ++&lt;br /&gt;
    PHI   MET   18   -87.4 -132.4    3.5   6  ++     +      +  ++&lt;br /&gt;
    CHI1  SER   19   -53.9 -168.9   11.6   8  ++      +++  ++   +&lt;br /&gt;
    CHI2  GLU   22   -75.8 -166.1    9.1   4        +  + +   +&lt;br /&gt;
    CHI2  LYS   32   -86.5 -176.9    3.7   2          +         +&lt;br /&gt;
    CHI1  GLU   36    60.4  169.0    3.3   4        +      + +  +&lt;br /&gt;
    CHI1  VAL   42    70.4 -174.5    2.6   7    + +  +   +++    +&lt;br /&gt;
    CHI3  GLN   46   -23.5   21.6    4.4   4      + +      +  +&lt;br /&gt;
    CHI2  ARG   48   -68.8 -124.9    3.2   1            +&lt;br /&gt;
    CHI1  LYS   53  -175.2   74.4    7.4   5 ++    ++     +&lt;br /&gt;
    PSI   LYS   53   -30.8  159.5    0.6   4      + +      +  +&lt;br /&gt;
    PHI   ASN   54   -89.1   62.6    2.1   4      + +      +  +&lt;br /&gt;
    CHI1  GLU   61   -74.7   59.2    9.7   7 + +  +  +   +  ++&lt;br /&gt;
    CHI1  GLU   65    83.2  -32.8    1.2   9        ++++ ++ + + +&lt;br /&gt;
    CHI1  THR   66    62.3 -175.9    8.8   9  + ++        + +++++&lt;br /&gt;
    CHI2  LYS   68   168.0   75.9   10.4   7          ++ ++   +++&lt;br /&gt;
    CHI1  ARG   73   -93.1 -159.1    8.2  10  ++  + +++    ++  ++&lt;br /&gt;
    CHI2  ARG   73   -67.3   64.2    3.7   8  ++  +  ++    +   ++&lt;br /&gt;
    CHI4  ARG   73  -179.8   76.8    9.1   6  ++    ++   +     +&lt;br /&gt;
    CHI1  SER   81   -77.2  171.3   11.2   9 + ++ + +  +++    +&lt;br /&gt;
    CHI1  CYS   82  -172.8  -78.5   11.7   9 +      ++  + + ++ ++&lt;br /&gt;
    PSI   LYS   88    71.3  159.9    1.4   6     ++ + +  +    +&lt;br /&gt;
    24 split dihedral angle distributions.&lt;br /&gt;
&lt;br /&gt;
These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.  &lt;br /&gt;
Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics are reported:&lt;br /&gt;
    Ramachandran plot outliers:&lt;br /&gt;
                  #  1   5   10   15   20&lt;br /&gt;
    LYS    88     1  ....* ... ....... ..&lt;br /&gt;
    Residues in most favored regions        :  89.1 %&lt;br /&gt;
    Residues in additionally allowed regions:  10.8 % (symbol: .)&lt;br /&gt;
    Residues in generously allowed regions  :   0.0 % (symbol: +)&lt;br /&gt;
    Residues in disallowed regions          :   0.1 % (symbol: *)&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_longrangeplot&amp;diff=7676</id>
		<title>CYANA Macro: longrangeplot</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_longrangeplot&amp;diff=7676"/>
		<updated>2010-01-12T16:23:37Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ps: (default: longrangeplot.ps)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Plots long-range distance restraints (five or more residues apart) versus&lt;br /&gt;
(two copies of) the sequence. Lines going from upper left to lower right&lt;br /&gt;
represent restraints between side-chain atoms, those going from lower left&lt;br /&gt;
to upper right represent restraints that involve backbone atoms.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_kringle&amp;diff=7675</id>
		<title>CYANA Macro: kringle</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_kringle&amp;diff=7675"/>
		<updated>2010-01-12T16:20:41Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ps: (default: kringle.ps)&lt;br /&gt;
; delta=&#039;&#039;real&#039;&#039;: (default: 30.0)&lt;br /&gt;
; errorbars&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Produces a graphics output file with the given name (a Graf file if the extension is “.grf”, or a Postscript file otherwise) containing a plot of &amp;lt;sup&amp;gt;3&amp;lt;/sup&amp;gt;&#039;&#039;J&#039;&#039;&amp;lt;sub&amp;gt;αβ2&amp;lt;/sub&amp;gt; versus &amp;lt;sup&amp;gt;3&amp;lt;/sup&amp;gt;&#039;&#039;J&#039;&#039;&amp;lt;sub&amp;gt;αβ3&amp;lt;/sub&amp;gt;  couplings (Nagayama &amp;amp; Wüthrich, 1981). The theoretical curve based on the Karplus equation given in the library is also drawn, both for a rigid structure (solid line) and for the situation when the χ&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt; angle is uniformly distributed in the interval &#039;&#039;delta&#039;&#039; around a given value (dotted line). Optionally, &#039;&#039;&#039;errorbars&#039;&#039;&#039; can be shown for the coupling constant values.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_kringle&amp;diff=7674</id>
		<title>CYANA Macro: kringle</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_kringle&amp;diff=7674"/>
		<updated>2010-01-12T16:20:12Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ps: (default: kringle.ps)&lt;br /&gt;
; delta=&#039;&#039;real&#039;&#039;: (default: 30.0)&lt;br /&gt;
; errorbars&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Produces a graphics output file with the given name (a Graf file if the extension is “.grf”, or a Postscript file otherwise) containing a plot of &amp;lt;sup&amp;gt;3&amp;lt;/sup&amp;gt;&#039;&#039;J&#039;&#039;&amp;lt;sub&amp;gt;αβ2&amp;lt;/sub&amp;gt; versus &amp;lt;sup&amp;gt;3&amp;lt;/sup&amp;gt;&#039;&#039;J&#039;&#039;&amp;lt;sub&amp;gt;αβ3&amp;lt;/sub&amp;gt;  couplings (Nagayama &amp;amp; Wüthrich, 1981). The theoretical curve based on the Karplus equation given in the library is also drawn, both for a rigid structure (solid line) and for the situation when the χ&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt; angle is uniformly distributed in the interval &#039;delta&#039;&#039; around a given value (dotted line). Optionally, &#039;&#039;&#039;errorbars&#039;&#039;&#039; can be shown for the coupling constant values.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_initsafe&amp;diff=7673</id>
		<title>CYANA Macro: initsafe</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_initsafe&amp;diff=7673"/>
		<updated>2010-01-12T15:59:42Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; (none)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Startup macro for &amp;quot;safe&amp;quot; mode. This macro is executed before any other initialization macros when the program is started with the &#039;&#039;&#039;-S&#039;&#039;&#039; option.  In safe mode, the program can access only standard macros and residue libraries, and files in the current working directory and its subdirectories. Access to other directories and the execution of shell commands with the &#039;&#039;&#039;system&#039;&#039;&#039; command are forbidden.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_init&amp;diff=7672</id>
		<title>CYANA Macro: init</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_init&amp;diff=7672"/>
		<updated>2010-01-12T15:52:46Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; (none)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Contains commands that are executed automatically at the start-up time of CYANA, e.g. the setting of important variables and the definition of some aliases. After the general &#039;&#039;&#039;init&#039;&#039;&#039; macro, a user-defined &#039;&#039;&#039;init&#039;&#039;&#039; macro in the current directory is executed, if available.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_habas&amp;diff=7671</id>
		<title>CYANA Macro: habas</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_habas&amp;diff=7671"/>
		<updated>2010-01-12T15:35:46Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; range=&#039;&#039;integer range&#039;&#039;: (default: &#039;&#039;all residues&#039;&#039;)&lt;br /&gt;
; angles=&#039;&#039;string&#039;&#039;: (default: CHI1)&lt;br /&gt;
; tfcut=&#039;&#039;real&#039;&#039;: (default: 0.0)&lt;br /&gt;
; continue&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs for all amino acid residues in the given &#039;&#039;range&#039;&#039; grid searches comprising the backbone dihedral angles φ, ψ and the given side chain &#039;&#039;angles&#039;&#039;. To specify more than one side-chain angle, the names must be given, separated by blanks and enclosed in double quotes. If the cutoff value for the local, fragment-based target function, fmax, is positive, then all conformations with a local target function value below fmax will be considered as allowed. Otherwise, a conformation will be allowed if no single restraint violation exceeds the corresponding cutoff value defined by the variables [[CYANA Variables: soft_upl|&#039;&#039;&#039;soft_upl&#039;&#039;&#039;]], [[CYANA Variables: soft_lol|&#039;&#039;&#039;soft_lol&#039;&#039;&#039;]], etc. Unless the &#039;&#039;&#039;continue&#039;&#039;&#039; option is set, the allowed ranges of dihedral angles will be initialized to allow all possible angle values before the grid searches are started. This macro provides the functions of the former Habas program (Güntert et al., 1989). The results include dihedral angle restraints and, if possible, stereospecific assignments for the diastereotopic groups in the fragment.&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;habas angles=”CHI1 CHI2*” tfcut=0.05&#039;&#039;&#039; Perform grid searches for all amino acid residues including the dihedral angles φ, ψ, χ&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt; and χ&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;. Allow conformations with local target function values up to 0.05.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_habas&amp;diff=7670</id>
		<title>CYANA Macro: habas</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_habas&amp;diff=7670"/>
		<updated>2010-01-12T15:30:00Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; range=&#039;&#039;integer range&#039;&#039;: (default: &#039;&#039;all residues&#039;&#039;)&lt;br /&gt;
; angles=&#039;&#039;string&#039;&#039;: (default: CHI1)&lt;br /&gt;
; tfcut=&#039;&#039;real&#039;&#039;: (default: 0.0)&lt;br /&gt;
; continue&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs for all amino acid residues in the given &#039;&#039;range&#039;&#039; grid searches comprising the backbone dihedral angles φ, ψ and the given side chain &#039;&#039;angles&#039;&#039;. To specify more than one side-chain angle, the names must be given, separated by blanks and enclosed in double quotes. If the cutoff value for the local, fragment-based target function, fmax, is positive, then all conformations with a local target function value below fmax will be considered as allowed. Otherwise, a conformation will be allowed if no single restraint violation exceeds the corresponding cutoff value defined by the variables [[CYANA Variables: soft_upl|&#039;&#039;&#039;soft_upl&#039;&#039;&#039;]], [[CYANA Variables: soft_lol|&#039;&#039;&#039;soft_lol&#039;&#039;&#039;]], etc. Unless the &#039;&#039;&#039;continue&#039;&#039;&#039; option is set, the allowed ranges of dihedral angles will be initialized to allow all possible angle values before the grid searches are started. This macro provides the functions of the former Habas program (Güntert et al., 1989). The results include dihedral angle restraints and, if possible, stereospecific assignments for the diastereotopic groups in the fragment.&lt;br /&gt;
&lt;br /&gt;
 &#039;&#039;&#039;habas angles=”CHI1 CHI2*” tfcut=0.05&#039;&#039;&#039; Perform grid searches for all amino acid residues including the dihedral angles φ, ψ, χ&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt; and χ&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;. Allow conformations with local target function values up to 0.05.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_graf&amp;diff=7669</id>
		<title>CYANA Macro: graf</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_graf&amp;diff=7669"/>
		<updated>2010-01-12T15:23:52Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ps: (required)&lt;br /&gt;
; replace&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Convert a graphics file into a Postscript plot file. If &#039;&#039;&#039;file&#039;&#039;&#039; has the extension “.grf”, nothing happens. Otherwise a Postscript file is produced from the corresponding graphics file with extension &amp;quot;.grf&amp;quot;. If the option &#039;&#039;&#039;replace&#039;&#039;&#039; is set, then the graphics file is removed after the Postscript file has been produced.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_garant&amp;diff=7668</id>
		<title>CYANA Macro: garant</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_garant&amp;diff=7668"/>
		<updated>2010-01-12T15:17:17Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Parameters */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; name=&#039;&#039;string&#039;&#039;: (default: $name or &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; runs=&#039;&#039;integer&#039;&#039;: (default: 1)&lt;br /&gt;
; sequence=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; dref=&#039;&#039;real&#039;&#039;: (default: 4.0)&lt;br /&gt;
; accuracy_H=&#039;&#039;real&#039;&#039;: (default: $max(tolerance(1),tolerance(2)))&lt;br /&gt;
; accuracy_N=&#039;&#039;real&#039;&#039;: (default: $tolerance(3))&lt;br /&gt;
; accuracy_C=&#039;&#039;real&#039;&#039;: (default: $tolerance(3))&lt;br /&gt;
; calibration=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; garant=&#039;&#039;string&#039;&#039;: (default: garant)&lt;br /&gt;
; assign=&#039;&#039;string&#039;&#039;: (default: assign)&lt;br /&gt;
&lt;br /&gt;
== Defined spectrum types ==&lt;br /&gt;
                                                      w1    w2    w3    w4&lt;br /&gt;
* COSY ...... homonuclear COSY H H TOCSY ..... homonuclear TOCSY H H&lt;br /&gt;
NOESY ..... homonuclear NOESY H H D2OCOSY ... homonuclear COSY no&lt;br /&gt;
H_AMI observed H H D2OTOCSY .. homonuclear TOCSY no H_AMI observed H&lt;br /&gt;
H D2ONOESY .. homonuclear NOESY no H_AMI observed H H&lt;br /&gt;
&lt;br /&gt;
C13H1 ..... [13C,1H]-COSY C H N15H1 ..... [15N,1H]-COSY N H&lt;br /&gt;
&lt;br /&gt;
N15TOCSY .. 3D 15N-correlated [1H,1H]-TOCSY N HN H　RELTOCSY .. 2D&lt;br /&gt;
15N-correlated [1H,1H]-TOCSY N H N15NOESY .. 3D 15N-correlated [1H,1H]-NOESY N HN H C13NOESY .. 3D 13C-correlated [1H,1H]-NOESY&lt;br /&gt;
C H H C13NOED2O . 3D 13C-correlated [1H,1H]-NOESY in D2O C H H CCNOESY ... 4D [13C,13C]-correlated [1H,1H]-NOESY C H H C CNNOESY&lt;br /&gt;
... 4D [13C,15N]-correlated [1H,1H]-NOESY C H HN N NNNOESY ... 4D [15N,15N]-correlated [1H,1H]-NOESY N HN HN N&lt;br /&gt;
&lt;br /&gt;
HNHB ...... heteronuclear HNHB experiment N HN HB HNHA&lt;br /&gt;
...... heteronuclear HNHA experiment N HN HA&lt;br /&gt;
&lt;br /&gt;
HCCH24 .... HCCH-TOCSY with long mixing time C H H HCCH7 ..... HCCH-TOCSY&lt;br /&gt;
with short mixing time C H H CCH ....... CCH-TOCSY with long mixing time H C C&lt;br /&gt;
&lt;br /&gt;
H_CA_NH ... heteronuclear H[CA]NH experiment HA N HN HN&lt;br /&gt;
...... heteronuclear HNCA experiment HN N CA HN_CO_CA .. heteronuclear&lt;br /&gt;
HN[CO]CA experiment HN N CA HN_CA_CO .. heteronuclear HN[CA]CO&lt;br /&gt;
experiment HN N CO HNCO ...... heteronuclear HNCO experiment HN&lt;br /&gt;
 N CO HCACO ..... heteronuclear HCACO experiment HA CA CO HCA_CO_N&lt;br /&gt;
 .. heteronuclear H[CA]CON experiment HA CO N CBCANH .... heteronuclear&lt;br /&gt;
 CBCANHN experiment HN N CA/CB CBCACONH .. heteronuclear CBCA(CO)NHN&lt;br /&gt;
 experiment HN N CA/CB HBHANH .... heteronuclear HBHANHN experiment HN&lt;br /&gt;
 N HA/HB HBHACONH .. heteronuclear HBHA(CO)NHN experiment HN N HA/HB&lt;br /&gt;
&lt;br /&gt;
 C_CO_NH ... C(CCO)NH experiment HN N C HC_CO_NH .. H(CCO)NH experiment&lt;br /&gt;
 HN N C&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs automated resonance assignment using the external program GARANT (Bartels et al., 1996; Bartels et al., 1997). Multiple &#039;&#039;runs&#039;&#039; of the program Garant with identical input data but different random number generator seed values can be executed. The input peak lists must have the name of the corresponding spectrum types:&lt;br /&gt;
                                                      &lt;br /&gt;
 COSY      homonuclear COSY&lt;br /&gt;
 TOCSY     homonuclear TOCSY&lt;br /&gt;
 NOESY     homonuclear NOESY&lt;br /&gt;
 D2OCOSY   homonuclear COSY in D&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&lt;br /&gt;
 D2OTOCSY  homonuclear TOCSY in D&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&lt;br /&gt;
 D2ONOESY  homonuclear NOESY in D&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&lt;br /&gt;
 C13H1     [&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-COSY	&lt;br /&gt;
 N15H1     [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-COSY	&lt;br /&gt;
 N15TOCSY  3D &amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-TOCSY&lt;br /&gt;
 RELTOCSY  2D &amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-TOCSY	&lt;br /&gt;
 N15NOESY  3D &amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 C13NOESY  3D &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 C13NOED2O 3D &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 CCNOESY   4D [&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 CNNOESY   4D [&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N]-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 NNNOESY   4D [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N]-correlated [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H]-NOESY&lt;br /&gt;
 HNHB      heteronuclear HNHB experiment&lt;br /&gt;
 HNHA      heteronuclear HNHA experiment&lt;br /&gt;
 HCCH24    HCCH-TOCSY&lt;br /&gt;
 HCCH7     HCCH-COSY&lt;br /&gt;
 CCH       CCH-TOCSY &lt;br /&gt;
 H_CA_NH   heteronuclear H(CA)NH experiment&lt;br /&gt;
 HNCA      heteronuclear HNCA experiment&lt;br /&gt;
 HN_CO_CA  heteronuclear HN(CO)CA experiment&lt;br /&gt;
 HN_CA_CO  heteronuclear HN(CA)CO experiment&lt;br /&gt;
 HNCO      heteronuclear HNCO experiment&lt;br /&gt;
 HCACO     heteronuclear H(CA)CO experiment&lt;br /&gt;
 HCA_CO_N  heteronuclear H(CA)CON experiment&lt;br /&gt;
 CBCANH    heteronuclear CBCANH experiment&lt;br /&gt;
 CBCACONH  heteronuclear CBCA(CO)NH experiment&lt;br /&gt;
 HBHACONH  heteronuclear HBHA(CO)NH experiment&lt;br /&gt;
 C_CO_NH   C(CCO)NH experiment&lt;br /&gt;
 HC_CO_NH  H(CCO)NH experiment&lt;br /&gt;
 HBCBCGHE  HBCBCGHE experiment for SAIL aromatics (Torizawa et al., 2005)&lt;br /&gt;
 CBCGHE    CBCGHE experiment for SAIL aromatics (Torizawa et al., 2005)&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_forall&amp;diff=7667</id>
		<title>CYANA Macro: forall</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_forall&amp;diff=7667"/>
		<updated>2010-01-12T14:58:18Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; &#039;&#039;parameters&#039;&#039;&lt;br /&gt;
; save&lt;br /&gt;
; parallel&lt;br /&gt;
; skip&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
This macro performs a loop over all selected structures, copies them into the structure memory #0, executes the user &#039;&#039;commands&#039;&#039;, and copies the structure back to the structure memory. Optionally, the structures are saved as angle files with names &#039;&#039;dnnnmmm&#039;&#039;.ang (&#039;&#039;nnn&#039;&#039; denotes the current process number, and &#039;&#039;mmm&#039;&#039; the structure number) before they are copied back. The calculation may be executed in &#039;&#039;&#039;parallel&#039;&#039;&#039; (if the INCLAN variable &#039;&#039;&#039;nproc&#039;&#039;&#039; has a value larger than 1). &lt;br /&gt;
&lt;br /&gt;
 &#039;&#039;&#039;forall parallel &amp;quot;vtfmin steps=100,800; angstat make&amp;quot;&#039;&#039;&#039; &lt;br /&gt;
Minimize all selected structures using the macro &#039;&#039;&#039;vtfmin&#039;&#039;&#039; with the given number of steps and include the resulting structures into the angle statistics.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_flip&amp;diff=7666</id>
		<title>CYANA Macro: flip</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_flip&amp;diff=7666"/>
		<updated>2010-01-12T14:53:55Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; (none)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Flips planes of aromatic rings of PHE and TYR residues and planar groups of ASP- and GLU- by 180&amp;lt;sup&amp;gt;o&amp;lt;/sup&amp;gt; such that there is a best fit between all selected structures. This command does not affect the three-dimensional structure. The change is limited to the nomenclature which results in a lower heavy atom RMSD.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_dinucleotide&amp;diff=7665</id>
		<title>CYANA Macro: dinucleotide</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_dinucleotide&amp;diff=7665"/>
		<updated>2010-01-12T14:51:17Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; range=&#039;&#039;integer range&#039;&#039;: (default: &#039;&#039;all residues&#039;&#039;)&lt;br /&gt;
; tfcut=&#039;&#039;real&#039;&#039;: (default: 0.0)&lt;br /&gt;
; continue&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs grid searches for all dinucleotide fragments in the given &#039;&#039;range&#039;&#039;. If the cutoff value for the local, fragment-based target function, fmax is positive, then all conformations with a local target function value below fmax will be considered as allowed. Otherwise, i.e. if fmax = 0.0, a conformation will be allowed if no single restraint violation exceeds the corresponding cutoff value defined by the variables [[CYANA Variables: soft_upl|&#039;&#039;&#039;soft_upl&#039;&#039;&#039;]], [[CYANA Variables: soft_lol|&#039;&#039;&#039;soft_lol&#039;&#039;&#039;]], etc. Unless the &#039;&#039;&#039;continue&#039;&#039;&#039; option is set, the allowed ranges of dihedral angles will be initialized to allow all possible angle values before the grid searches are started. The results include dihedral angle restraints and, if possible, stereospecific assignments for the diastereotopic groups in the fragment.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_dcostat&amp;diff=7663</id>
		<title>CYANA Macro: dcostat</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_dcostat&amp;diff=7663"/>
		<updated>2010-01-12T14:46:40Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&#039;&#039;filename&#039;&#039;.ps: (default: dcostat.ps)&lt;br /&gt;
; classes=&#039;&#039;integer&#039;&#039;: (default: 3)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Produces a graphics output file with the given name (a Graf file if the extension is &amp;quot;.grf&amp;quot;, or a Postscript file otherwise) with two plots that show the distribution of distance restraints. The first plot shows the number of distance restraints plotted against the residue index difference of the corresponding atoms. The second plot shows for every residue the number of intra-residual (white), short range (vertically hatched), medium-range (horizontally hatched) and long-range (black) restraints.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_cashiftaco&amp;diff=7658</id>
		<title>CYANA Macro: cashiftaco</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_cashiftaco&amp;diff=7658"/>
		<updated>2010-01-12T14:40:36Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; offset=&#039;&#039;real&#039;&#039;: (default: 0.0)&lt;br /&gt;
; prooffset=&#039;&#039;real&#039;&#039;: (default: 2.0)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Generates restraints for the backbone dihedral angles Φ and Ψ in proteins by comparing the C&amp;lt;sup&amp;gt;α&amp;lt;/sup&amp;gt; chemical shifts with the corresponding random coil values of Spera &amp;amp; Bax (1991). Angle restraints are derived according to the rules of Luginbühl et al. (1995). The C&amp;lt;sup&amp;gt;α&amp;lt;/sup&amp;gt; random coil shifts are relative to internal TSP. Optionally, an &#039;&#039;&#039;offset&#039;&#039;&#039; Δω is added to the chemical shifts in the proton list. A warning is printed for C&amp;lt;sup&amp;gt;α&amp;lt;/sup&amp;gt; chemical shifts that deviate by more than 15 ppm from their random coil value.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7657</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7657"/>
		<updated>2010-01-12T14:36:45Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|sidechain&lt;br /&gt;
|not &amp;quot;backbone&amp;quot; and not &amp;quot;methyl&amp;quot;&lt;br /&gt;
|V = B / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|methyl&lt;br /&gt;
|all involving methyl groups&lt;br /&gt;
|V = C / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
          &lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user (A = &#039;&#039;bb&#039;&#039;, B = &#039;&#039;sc&#039;&#039; and C = &#039;&#039;methyl&#039;&#039;), or calculated automatically using the function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] to determine A by assuming an average distance &#039;&#039;avedis&#039;&#039; for the restraints in the class “backbone” and setting B = A / up1_values(1) and C = B / 3.&lt;br /&gt;
&lt;br /&gt;
Optionally, the resulting distance restraints may be given a relative &#039;&#039;weight&#039;&#039;, and a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be written.&lt;br /&gt;
&lt;br /&gt;
== Further reading ==&lt;br /&gt;
&lt;br /&gt;
* Güntert et al. J. Mol. Biol. 217, 517-530 (1991).&lt;br /&gt;
* Güntert et al. J. Mol. Biol. 217, 531-540 (1991).&lt;br /&gt;
* Mumenthaler et al. J. Biomol. NMR. 10, 351-362 (1997).&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7656</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7656"/>
		<updated>2010-01-12T14:27:33Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|sidechain&lt;br /&gt;
|not &amp;quot;backbone&amp;quot; and not &amp;quot;methyl&amp;quot;&lt;br /&gt;
|V = B / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|methyl&lt;br /&gt;
|all involving methyl groups&lt;br /&gt;
|V = C / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
          &lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user (A = &#039;&#039;bb&#039;&#039;, B = &#039;&#039;sc&#039;&#039; and C = &#039;&#039;methyl&#039;&#039;), or calculated automatically using the function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] to determine A by assuming an average distance &#039;&#039;avedis&#039;&#039; for the restraints in the class “backbone” and setting B = A / up1_values(1) and C = B / 3.&lt;br /&gt;
&lt;br /&gt;
Optionally, the resulting distance restraints may be given a relative &#039;&#039;weight&#039;&#039;, and a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be written.&lt;br /&gt;
&lt;br /&gt;
== Further reading ==&lt;br /&gt;
&lt;br /&gt;
* Guntert et al. J. Mol. Biol. 217, 517-530 (1991).&lt;br /&gt;
* Guntert et al. J. Mol. Biol. 217, 531-540 (1991).&lt;br /&gt;
* Mumenthaler et al. J. Biomol. NMR. 10, 351-362 (1997).&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7655</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7655"/>
		<updated>2010-01-12T14:25:10Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|sidechain&lt;br /&gt;
|not &amp;quot;backbone&amp;quot; and not &amp;quot;methyl&amp;quot;&lt;br /&gt;
|V = B / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|methyl&lt;br /&gt;
|all involving methyl groups&lt;br /&gt;
|V = C / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
          &lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user (A = &#039;&#039;bb&#039;&#039;, B = &#039;&#039;sc&#039;&#039; and C = &#039;&#039;methyl&#039;&#039;), or calculated automatically using the function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] to determine A by assuming an average distance &#039;&#039;avedis&#039;&#039; for the restraints in the class “backbone” and setting B = A / up1_values(1) and C = B / 3.&lt;br /&gt;
&lt;br /&gt;
Optionally, the resulting distance restraints may be given a relative &#039;&#039;weight&#039;&#039;, and a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be written.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7654</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7654"/>
		<updated>2010-01-12T14:24:41Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|sidechain&lt;br /&gt;
|not &amp;quot;backbone&amp;quot; and not &amp;quot;methyl&amp;quot;&lt;br /&gt;
|V = B / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
|methyl&lt;br /&gt;
|all involving methyl groups&lt;br /&gt;
|V = C / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
          &lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user (A = &#039;&#039;bb&#039;&#039;, B = &#039;&#039;sc&#039;&#039; and C = &#039;&#039;methyl&#039;&#039;), or calculated automatically using the function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] to determine A by assuming an average distance &#039;&#039;avedis&#039;&#039; for the restraints in the class “backbone” and setting B = A / up1_values(1) and C = B / 3.&lt;br /&gt;
&lt;br /&gt;
Optionally, the resulting distance restraints may be given a relative &#039;&#039;weight&#039;&#039;, and a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be written.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7653</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7653"/>
		<updated>2010-01-12T14:23:58Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|sidechain&lt;br /&gt;
|not &amp;quot;backbone&amp;quot; and not &amp;quot;methyl&amp;quot;&lt;br /&gt;
|V = B / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|methyl&lt;br /&gt;
|all involving methyl groups&lt;br /&gt;
|V = C / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
          &lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user (A = &#039;&#039;bb&#039;&#039;, B = &#039;&#039;sc&#039;&#039; and C = &#039;&#039;methyl&#039;&#039;), or calculated automatically using the function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] to determine A by assuming an average distance &#039;&#039;avedis&#039;&#039; for the restraints in the class “backbone” and setting B = A / up1_values(1) and C = B / 3.&lt;br /&gt;
&lt;br /&gt;
Optionally, the resulting distance restraints may be given a relative &#039;&#039;weight&#039;&#039;, and a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be written.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7652</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7652"/>
		<updated>2010-01-12T14:16:20Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|sidechain&lt;br /&gt;
|not &amp;quot;backbone&amp;quot; and not &amp;quot;methyl&amp;quot;&lt;br /&gt;
|V = B / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|methyl&lt;br /&gt;
|all involving methyl groups&lt;br /&gt;
|V = C / d&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7651</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7651"/>
		<updated>2010-01-12T14:14:18Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7650</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7650"/>
		<updated>2010-01-12T14:13:58Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|   backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|   V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7649</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7649"/>
		<updated>2010-01-12T14:13:25Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
:::|Peaks/restraints&lt;br /&gt;
:::|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|:::HN/HA - HN/HA,&lt;br /&gt;
:::HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|:::V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7648</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7648"/>
		<updated>2010-01-12T14:13:05Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|:::Peaks/restraints&lt;br /&gt;
|:::Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|:::HN/HA - HN/HA,&lt;br /&gt;
:::HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|:::V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7647</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7647"/>
		<updated>2010-01-12T14:12:16Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7646</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7646"/>
		<updated>2010-01-12T14:11:50Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
{|&lt;br /&gt;
|Class&lt;br /&gt;
|Peaks/restraints&lt;br /&gt;
|Function&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
|backbone&lt;br /&gt;
|HN/HA - HN/HA,&lt;br /&gt;
:HN/HA - HA (|&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| &amp;lt; 5)&lt;br /&gt;
&lt;br /&gt;
|V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
|-&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7645</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7645"/>
		<updated>2010-01-12T14:05:41Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
&lt;br /&gt;
Class------------Peaks/restraints----------Function&lt;br /&gt;
&lt;br /&gt;
backbone---------HN/HA - HN/HA,------------V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7644</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7644"/>
		<updated>2010-01-12T13:54:21Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
&lt;br /&gt;
Class     Peaks/restraints     Function&lt;br /&gt;
&lt;br /&gt;
backbone  HN/HA - HN/HA,        V = A / d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7643</id>
		<title>CYANA Macro: caliba</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_caliba&amp;diff=7643"/>
		<updated>2010-01-12T13:52:34Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; vmin=&#039;&#039;real&#039;&#039;: (default: 100.0)&lt;br /&gt;
; bb=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; sc=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; methyl=&#039;&#039;real&#039;&#039;: (default: -1.0)&lt;br /&gt;
; weight=&#039;&#039;real&#039;&#039;: (default: 1.0)&lt;br /&gt;
; avedis=&#039;&#039;real&#039;&#039;: (default: 3.4)&lt;br /&gt;
; plot=&#039;&#039;filename&#039;&#039;.ps: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calibrates a peak list, i.e. derives upper limit distance restraints from all assigned peaks and adds them to the list of current distance restraints. Optionally, only peaks with volume larger than &#039;&#039;vmin&#039;&#039; or from a peak list with given filename (without extension) may be considered. Peaks are classified into three calibration classes:&lt;br /&gt;
&lt;br /&gt;
Class     Peaks/restraints     Function&lt;br /&gt;
&lt;br /&gt;
backbone  HN/HA -HN/HA,        V = A/d&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&lt;br /&gt;
          &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
* The “backbone” class includes all distance restraints between the backbone amide and α protons that are less than five residues apart from each other. A relationship &#039;&#039;V = A / u&amp;lt;sup&amp;gt;6&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed. &lt;br /&gt;
* The “sidechain” class includes all distance restraints that do not belong to one of the other classes. A relationship &#039;&#039;V = B / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039; between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
* The “methyl” class includes all distance restraints that involve a methyl group. A relationship &#039;&#039;V = C / u&amp;lt;sup&amp;gt;4&amp;lt;/sup&amp;gt;&#039;&#039;  between the peak volume &#039;&#039;V&#039;&#039; and the upper distance bound &#039;&#039;u&#039;&#039; is assumed.&lt;br /&gt;
&lt;br /&gt;
The parameters &#039;&#039;A&#039;&#039;, &#039;&#039;B&#039;&#039;, &#039;&#039;C&#039;&#039; are either given by the user as &#039;&#039;A = bb&#039;&#039;, &#039;&#039;B = sc&#039;&#039; and &#039;&#039;C = methyl&#039;&#039;, or calculated automatically as follows: The function [[CYANA Functions: calscale|&#039;&#039;&#039;calscale&#039;&#039;&#039;]] is used to calculate &#039;&#039;A&#039;&#039; by assuming an average distance &#039;&#039;avedis&#039;&#039; for all restraints in the class “backbone”. By default, the scalar &#039;&#039;B&#039;&#039; is set to &#039;&#039;B = A / d&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039;  , where &#039;&#039;d&amp;lt;sub&amp;gt;min&amp;lt;/sub&amp;gt;&#039;&#039; is the minimal upper distance bound given by the system variable [[CYANA Variables: upl_values|&#039;&#039;&#039;upl_values&#039;&#039;&#039;]], and &#039;&#039;C&#039;&#039; is set to &#039;&#039;B / 3&#039;&#039; (Mumenthaler et al., 1997). Optionally, a logarithmic plot of volumes versus corresponding minimal distances in the selected structures can be created.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_calc_all&amp;diff=7642</id>
		<title>CYANA Macro: calc all</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_calc_all&amp;diff=7642"/>
		<updated>2010-01-12T13:43:54Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; structures=&#039;&#039;integer&#039;&#039;: (default: 0)&lt;br /&gt;
; command=&#039;&#039;string&#039;&#039;: (default: anneal)&lt;br /&gt;
; serial&lt;br /&gt;
; broadcast&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Calculates a group of structures using the given &#039;&#039;command&#039;&#039; (with optional &#039;&#039;parameters&#039;&#039;) for each individual conformer. If the number of &#039;&#039;structures&#039;&#039; n is specified, the calculation will be performed starting from n random start conformers; otherwise the calculation is performed for all selected structures. Structure calculations are performed in parallel, if possible.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_anneal&amp;diff=7641</id>
		<title>CYANA Macro: anneal</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_anneal&amp;diff=7641"/>
		<updated>2010-01-12T13:41:11Z</updated>

		<summary type="html">&lt;p&gt;Miki: /* Description */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&#039;&#039;Simulated annealing&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; thigh=&#039;&#039;real&#039;&#039;: (default: 8.0)&lt;br /&gt;
; steps=&#039;&#039;integer&#039;&#039;: (default: 10000)&lt;br /&gt;
; highsteps=&#039;&#039;integer&#039;&#039;: (default: -1)&lt;br /&gt;
; minsteps=&#039;&#039;integer&#039;&#039;: (default: 1000)&lt;br /&gt;
; relax&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs simulated annealing on the current structure with a total of N MD steps, starting with Nhigh MD steps at temperature &#039;&#039;thigh&#039;&#039; followed by slow cooling during N - Nhigh MD steps to a final temperature of &#039;&#039;Tend&#039;&#039;. Finally, n steps of conjugate gradient minimization are added. The temperature is measured in target function units per degree of freedom. Optionally, more minimization can be performed in order to relax strong overlaps and restraint violations prior to the start of the MD calculation. The &#039;&#039;&#039;relax&#039;&#039;&#039; option can be useful for larger (above 200 residues) proteins if otherwise the maximal length of the pair list would be exceeded.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_anneal&amp;diff=7640</id>
		<title>CYANA Macro: anneal</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_anneal&amp;diff=7640"/>
		<updated>2010-01-12T13:38:34Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&#039;&#039;Simulated annealing&#039;&#039;&lt;br /&gt;
&lt;br /&gt;
== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; thigh=&#039;&#039;real&#039;&#039;: (default: 8.0)&lt;br /&gt;
; steps=&#039;&#039;integer&#039;&#039;: (default: 10000)&lt;br /&gt;
; highsteps=&#039;&#039;integer&#039;&#039;: (default: -1)&lt;br /&gt;
; minsteps=&#039;&#039;integer&#039;&#039;: (default: 1000)&lt;br /&gt;
; relax&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Performs simulated annealing on the current structure with a total of N MD &#039;&#039;steps&#039;&#039;, starting with Nhigh MD steps at temperature &#039;&#039;thigh&#039;&#039; followed by slow cooling during N - Nhigh MD steps to a final temperature of &#039;&#039;Tend&#039;&#039;. Finally, n steps of conjugate gradient minimization are added. The temperature is measured in target function units per degree of freedom. Optionally, more minimization can be performed in order to relax strong overlaps and restraint violations prior to the start of the MD calculation. The &#039;&#039;&#039;relax&#039;&#039;&#039; option can be useful for larger (above 200 residues) proteins if otherwise the maximal length of the pair list would be exceeded.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_structures_overlay&amp;diff=7639</id>
		<title>CYANA Command: structures overlay</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_structures_overlay&amp;diff=7639"/>
		<updated>2010-01-12T13:12:56Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
;　keep=&#039;&#039;string&#039;&#039;: (default:&#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; gap=&#039;&#039;real&#039;&#039;: (default: 0.4)&lt;br /&gt;
; decrease=&#039;&#039;real&#039;&#039;: (default: 1.2)&lt;br /&gt;
; cluster&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_peaks_set&amp;diff=7638</id>
		<title>CYANA Command: peaks set</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_peaks_set&amp;diff=7638"/>
		<updated>2010-01-12T13:11:30Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; selection=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; volume=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; upl=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; number=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; color=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; ppm1=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; ppm2=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; ppm3=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; ppm4=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; quality=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;br /&gt;
; integration=&#039;&#039;string&#039;&#039;: (default: &#039;&#039;blank&#039;&#039;)&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_peaks_create&amp;diff=7637</id>
		<title>CYANA Command: peaks create</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_peaks_create&amp;diff=7637"/>
		<updated>2010-01-12T13:08:13Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; distance=&#039;&#039;real range&#039;&#039;: (default: 0.0..4.0)&lt;br /&gt;
; structures=&#039;&#039;integer&#039;&#039;: (default: 1)&lt;br /&gt;
; format=&#039;&#039;string&#039;&#039;: (default: hH)&lt;br /&gt;
; additional                     &lt;br /&gt;
                  &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Deletes current peak lists and creates expected peaks using the&lt;br /&gt;
structures from the selected structure memories. Peaks are created if&lt;br /&gt;
the distance between two assigned proton (or pseudo atom) chemical&lt;br /&gt;
shifts is less than d in at least n of the selected structures. To&lt;br /&gt;
calculate distances where pseudo atoms are involved, a r-6 weighted&lt;br /&gt;
average distance is determined between all protons that are represented&lt;br /&gt;
by the pseudo atom. With the option additional, the current peaks&lt;br /&gt;
are not deleted and the expected peaks are only added if they are&lt;br /&gt;
not already present. Per default, a 2D peak list is created, but with&lt;br /&gt;
the options c13 or n15, a 3D 13C- or 15N-correlated NOESY peak list&lt;br /&gt;
is simulated.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_angles_set&amp;diff=7636</id>
		<title>CYANA Command: angles set</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_angles_set&amp;diff=7636"/>
		<updated>2010-01-12T11:18:24Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; selection=&#039;&#039;string&#039;&#039;             :(default: &amp;lt;blank&amp;gt;)&lt;br /&gt;
; value=&#039;&#039;string&#039;&#039;                 :(default: &amp;lt;blank&amp;gt;)&lt;br /&gt;
; free                           &lt;br /&gt;
; fixed                          &lt;br /&gt;
; rigid&lt;br /&gt;
; cis &lt;br /&gt;
; trans                          &lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Command to set properties of the torsion angles that match the selection &#039;&#039;string&#039;&#039;. By default, the selection made in the most recent&lt;br /&gt;
[[CYANA Commands: angles select|&#039;&#039;&#039;angles select&#039;&#039;&#039;]]&#039; command is used, or all angles if no selection has been made so far.&lt;br /&gt;
&lt;br /&gt;
The value of a torsion angle can be set with the parameter &#039;&#039;&#039;value&#039;&#039;&#039;. The &#039;&#039;string&#039;&#039; is a real number or a real expression that may contain the&lt;br /&gt;
symbol &#039;&#039;&#039;value&#039;&#039;&#039; to represent the current value of the torsion angle.&lt;br /&gt;
Torsion angle values are given in degrees.&lt;br /&gt;
&lt;br /&gt;
Torsion angles are fixed to their current value if the option &#039;&#039;&#039;fixed&#039;&#039;&#039; is given. Fixed torsion angles are non-rotatable and cannot be changed&lt;br /&gt;
during minimization or torsion angle dynamics.&lt;br /&gt;
&lt;br /&gt;
Torsion angles are made rotatable if the option &#039;&#039;&#039;free&#039;&#039;&#039; is given. Free torsion angles can be changed during minimization or torsion angle&lt;br /&gt;
dynamics.&lt;br /&gt;
&lt;br /&gt;
Initially, all torsion angles defined in the library are rotatable except for those called OMEGA, which are typically used for the&lt;br /&gt;
peptide bonds in polypeptides. OMEGA angles are fixed to 180 degrees (&#039;&#039;&#039;trans&#039;&#039;&#039;). Optionally, the OMEGA angle preceding a given amino acid&lt;br /&gt;
residue can be fixed to 0 degrees (&#039;&#039;&#039;cis&#039;&#039;&#039;) by a preceding the residue name in the sequence (.seq) file by a lowercase &#039;c&#039;.&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7635</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7635"/>
		<updated>2010-01-12T11:13:23Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&#039;&#039;real&#039;&#039;             :(default: 0.5)&lt;br /&gt;
; matchfactor=&#039;&#039;real&#039;&#039;             :(default: 0.5)&lt;br /&gt;
; violation=&#039;&#039;real&#039;&#039;               :(default: -1.0)&lt;br /&gt;
; probability=&#039;&#039;real&#039;&#039;             :(default: 0.2)&lt;br /&gt;
; quality=&#039;&#039;real&#039;&#039;                 :(default: 0.5)&lt;br /&gt;
; elasticity=&#039;&#039;real range&#039;&#039;        :(default: 1.0..1.0)&lt;br /&gt;
; confidence=&#039;&#039;real&#039;&#039;              :(default: 1.0)&lt;br /&gt;
; supportweight=&#039;&#039;real&#039;&#039;           :(default: 1.0)&lt;br /&gt;
; pathlength=&#039;&#039;integer&#039;&#039;           :(default: 3)&lt;br /&gt;
; prefer=&#039;&#039;integer&#039;&#039;               :(default: 999999)&lt;br /&gt;
; interrange=&#039;&#039;integer range&#039;&#039;     :(default: 0..)&lt;br /&gt;
; unassigned=&#039;&#039;real&#039;&#039;              :(default: 0.1)&lt;br /&gt;
; noartifact=&#039;&#039;string&#039;&#039;            :(default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of covalently constrained short distances, and the selected 3D conformers, if available. The &#039;&#039;&#039;assign&#039;&#039;&#039; command is used in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;&#039;&#039;assign&#039;&#039;&#039; command for the peaks that were NOT selected in the input peak lists, as well as a report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made by the &#039;&#039;&#039;assign&#039;&#039;&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 A.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
- Lines 3-6: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;: covalently constrained distance shorter than &#039;&#039;real&#039;&#039; Å.&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;integer&#039;&#039;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;real&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; Å.&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;/&#039;&#039;integer&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; Å.&lt;br /&gt;
:; ~&#039;&#039;integer&#039;&#039;: The peak with number &#039;&#039;integer&#039;&#039; connects two atoms that covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
- Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances&lt;br /&gt;
are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== Further reading ==&lt;br /&gt;
&lt;br /&gt;
* Herrmann et al. J. Mol. Biol. 319, 209-227 (2002). (Note that the algorithm implemented in the &#039;assign&#039; command differs significantly from the original CANDID algorithm described in this publication.)&lt;br /&gt;
* Guntert. Meth. Mol. Biol. 278, 353-378 (2004).&lt;br /&gt;
* Guntert. Prog. NMR Spectrosc. 43, 105-125 (2003).&lt;br /&gt;
* Jee &amp;amp; Guntert. J. Struct. Funct. Genom. 4, 179-189 (2003).&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7634</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7634"/>
		<updated>2010-01-12T11:11:34Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&#039;&#039;real&#039;&#039;             :(default: 0.5)&lt;br /&gt;
; matchfactor=&#039;&#039;real&#039;&#039;             :(default: 0.5)&lt;br /&gt;
; violation=&#039;&#039;real&#039;&#039;               :(default: -1.0)&lt;br /&gt;
; probability=&#039;&#039;real&#039;&#039;             :(default: 0.2)&lt;br /&gt;
; quality=&#039;&#039;real&#039;&#039;                 :(default: 0.5)&lt;br /&gt;
; elasticity=&#039;&#039;real range&#039;&#039;        :(default: 1.0..1.0)&lt;br /&gt;
; confidence=&#039;&#039;real&#039;&#039;              :(default: 1.0)&lt;br /&gt;
; supportweight=&#039;&#039;real&#039;&#039;           :(default: 1.0)&lt;br /&gt;
; pathlength=&#039;&#039;integer&#039;&#039;           :(default: 3)&lt;br /&gt;
; prefer=&#039;&#039;integer&#039;&#039;               :(default: 999999)&lt;br /&gt;
; interrange=&#039;&#039;integer range&#039;&#039;     :(default: 0..)&lt;br /&gt;
; unassigned=&#039;&#039;real&#039;&#039;              :(default: 0.1)&lt;br /&gt;
; noartifact=&#039;&#039;string&#039;&#039;            :(default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of covalently constrained short distances, and the selected 3D conformers, if available. The &#039;&#039;&#039;assign&#039;&#039;&#039; command is used in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;&#039;&#039;assign&#039;&#039;&#039; command for the peaks that were NOT selected in the input peak lists, as well as a report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made by the &#039;&#039;&#039;assign&#039;&#039;&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 A.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
- Lines 3-6: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;: covalently constrained distance shorter than &#039;&#039;real&#039;&#039; Å.&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;integer&#039;&#039;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;real&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; Å.&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;/&#039;&#039;integer&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; Å.&lt;br /&gt;
:; ~&#039;&#039;integer&#039;&#039;: The peak with number &#039;&#039;integer&#039;&#039; connects two atoms that covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
- Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances&lt;br /&gt;
are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== Further reading ==&lt;br /&gt;
&lt;br /&gt;
* Herrmann et al. J. Mol. Biol. 319, 209-227 (2002).&lt;br /&gt;
(Note that the algorithm implemented in the &#039;assign&#039; command differs significantly from the original CANDID algorithm described in this&lt;br /&gt;
  publication.)&lt;br /&gt;
* Guntert. Meth. Mol. Biol. 278, 353-378 (2004).&lt;br /&gt;
* Guntert. Prog. NMR Spectrosc. 43, 105-125 (2003).&lt;br /&gt;
* Jee &amp;amp; Guntert. J. Struct. Funct. Genom. 4, 179-189 (2003).&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7632</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7632"/>
		<updated>2010-01-12T10:45:40Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&#039;&#039;real&#039;&#039;             :(default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;: covalently constrained distance shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;integer&#039;&#039;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;real&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;/&#039;&#039;integer&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; ~&#039;&#039;integer&#039;&#039;: The peak with number &#039;&#039;integer&#039;&#039; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances&lt;br /&gt;
are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7631</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7631"/>
		<updated>2010-01-12T10:45:17Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             :(default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;: covalently constrained distance shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;integer&#039;&#039;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;real&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;/&#039;&#039;integer&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; ~&#039;&#039;integer&#039;&#039;: The peak with number &#039;&#039;integer&#039;&#039; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances&lt;br /&gt;
are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7630</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7630"/>
		<updated>2010-01-12T10:44:55Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;: covalently constrained distance shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;integer&#039;&#039;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &#039;&#039;integer&#039;&#039;/&#039;&#039;real&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; &#039;&#039;real&#039;&#039;/&#039;&#039;integer&#039;&#039;: peak with number &#039;&#039;integer&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;real&#039;&#039; A.&lt;br /&gt;
:; ~&#039;&#039;integer&#039;&#039;: The peak with number &#039;&#039;integer&#039;&#039; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances&lt;br /&gt;
are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7627</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7627"/>
		<updated>2010-01-12T10:38:06Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &amp;lt;quality&amp;gt; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &amp;lt;probability&amp;gt; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &amp;lt;real&amp;gt;: covalently constrained distance shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;integer&amp;gt;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;integer&amp;gt;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;real&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;real&amp;gt;/&amp;lt;integer&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; ~&amp;lt;integer&amp;gt;: The peak with number &amp;lt;integer&amp;gt; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &amp;lt;violation&amp;gt; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The contents of the assignment report is as follows:&lt;br /&gt;
&lt;br /&gt;
Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0...1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
Lines 3–6: Information about individual assignment possibilities: &lt;br /&gt;
&lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK : Good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff.&lt;br /&gt;
:; far : Structure based probability too low.&lt;br /&gt;
:; lone : Network anchoring based probability too low.&lt;br /&gt;
:; poor : Individual probabilities ok but overall probability too low.&lt;br /&gt;
&lt;br /&gt;
:Note that an assignment with “&#039;&#039;&#039;OK&#039;&#039;&#039;” is not necessarily used when forming a distance restraint from the peak. Even individually good assignments may be discarded because the overall quality of the peak assignments is too low, or because there exist other, much better assignments for the peak. &lt;br /&gt;
* Overall probability for the assignment possibility (%).&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%).&lt;br /&gt;
* Probability for agreement with input structure bundle (%).&lt;br /&gt;
* Probability derived from network anchoring (%).&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Å).&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;: Covalently constrained distance shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;: Peak number of a (symmetrically related) peak with the same assignment.&lt;br /&gt;
:;&#039;&#039;i&amp;lt;sub&amp;gt;1&amp;lt;/sub&amp;gt;&#039;&#039;/&#039;&#039;i&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;&#039;&#039;: Numbers of two peaks that relate the two atoms of the present assignment through a third atom.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;/&#039;&#039;r&#039;&#039;: Peak with number &#039;&#039;i&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;/&#039;&#039;i&#039;&#039;:	Peak with number &#039;&#039;i&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;~i&#039;&#039;: The peak with number &#039;&#039;i&#039;&#039; connects two atoms that are covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
&lt;br /&gt;
:For reasons of space, only the first few contributions are printed. An ellipsis “...” followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted assignments (marked by ‘+’ in lines 3–6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; parameter is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7626</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7626"/>
		<updated>2010-01-12T10:37:24Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &amp;lt;quality&amp;gt; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK: good assignment with probability above the &amp;lt;probability&amp;gt; cutoff&lt;br /&gt;
:; far: structure based probability too low&lt;br /&gt;
:; lone: network anchoring based probability too low&lt;br /&gt;
:; poor: individual probabilities ok but overall probability too low&lt;br /&gt;
* Overall probability for the assignment possibility (%)&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
* Probability for agreement with input structure bundle (%)&lt;br /&gt;
* Probability derived from network anchoring (%)&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &amp;lt;real&amp;gt;: covalently constrained distance shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;integer&amp;gt;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;integer&amp;gt;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;real&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;real&amp;gt;/&amp;lt;integer&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; ~&amp;lt;integer&amp;gt;: The peak with number &amp;lt;integer&amp;gt; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &amp;lt;violation&amp;gt; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The contents of the assignment report is as follows:&lt;br /&gt;
&lt;br /&gt;
Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0...1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
Lines 3–6: Information about individual assignment possibilities: &lt;br /&gt;
&lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK : Good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff.&lt;br /&gt;
:; far : Structure based probability too low.&lt;br /&gt;
:; lone : Network anchoring based probability too low.&lt;br /&gt;
:; poor : Individual probabilities ok but overall probability too low.&lt;br /&gt;
&lt;br /&gt;
:Note that an assignment with “&#039;&#039;&#039;OK&#039;&#039;&#039;” is not necessarily used when forming a distance restraint from the peak. Even individually good assignments may be discarded because the overall quality of the peak assignments is too low, or because there exist other, much better assignments for the peak. &lt;br /&gt;
* Overall probability for the assignment possibility (%).&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%).&lt;br /&gt;
* Probability for agreement with input structure bundle (%).&lt;br /&gt;
* Probability derived from network anchoring (%).&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Å).&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;: Covalently constrained distance shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;: Peak number of a (symmetrically related) peak with the same assignment.&lt;br /&gt;
:;&#039;&#039;i&amp;lt;sub&amp;gt;1&amp;lt;/sub&amp;gt;&#039;&#039;/&#039;&#039;i&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;&#039;&#039;: Numbers of two peaks that relate the two atoms of the present assignment through a third atom.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;/&#039;&#039;r&#039;&#039;: Peak with number &#039;&#039;i&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;/&#039;&#039;i&#039;&#039;:	Peak with number &#039;&#039;i&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;~i&#039;&#039;: The peak with number &#039;&#039;i&#039;&#039; connects two atoms that are covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
&lt;br /&gt;
:For reasons of space, only the first few contributions are printed. An ellipsis “...” followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted assignments (marked by ‘+’ in lines 3–6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; parameter is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7625</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7625"/>
		<updated>2010-01-12T10:33:37Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &amp;lt;quality&amp;gt; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
- Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
- First atom, identified by its name, residue name, and residue number&lt;br /&gt;
- Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
- Second atom, identified by its name, residue name and number&lt;br /&gt;
- Decision on assignment possibility:&lt;br /&gt;
:; &#039;OK&#039;: good assignment with probability above the &amp;lt;probability&amp;gt; cutoff&lt;br /&gt;
:; &#039;far&#039;, structure based probability too low&lt;br /&gt;
:; &#039;lone&#039;, network anchoring based probability too low&lt;br /&gt;
:; &#039;poor&#039;, individual probabilities ok but overall probability too low&lt;br /&gt;
- Overall probability for the assignment possibility (%)&lt;br /&gt;
- Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
- Probability for agreement with input structure bundle (%)&lt;br /&gt;
- Probability derived from network anchoring (%)&lt;br /&gt;
- Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
- Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &amp;lt;real&amp;gt;: covalently constrained distance shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;integer&amp;gt;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;integer&amp;gt;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;real&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;real&amp;gt;/&amp;lt;integer&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; ~&amp;lt;integer&amp;gt;: The peak with number &amp;lt;integer&amp;gt; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &amp;lt;violation&amp;gt; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The contents of the assignment report is as follows:&lt;br /&gt;
&lt;br /&gt;
Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0...1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
Lines 3–6: Information about individual assignment possibilities: &lt;br /&gt;
&lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK : Good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff.&lt;br /&gt;
:; far : Structure based probability too low.&lt;br /&gt;
:; lone : Network anchoring based probability too low.&lt;br /&gt;
:; poor : Individual probabilities ok but overall probability too low.&lt;br /&gt;
&lt;br /&gt;
:Note that an assignment with “&#039;&#039;&#039;OK&#039;&#039;&#039;” is not necessarily used when forming a distance restraint from the peak. Even individually good assignments may be discarded because the overall quality of the peak assignments is too low, or because there exist other, much better assignments for the peak. &lt;br /&gt;
* Overall probability for the assignment possibility (%).&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%).&lt;br /&gt;
* Probability for agreement with input structure bundle (%).&lt;br /&gt;
* Probability derived from network anchoring (%).&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Å).&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;: Covalently constrained distance shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;: Peak number of a (symmetrically related) peak with the same assignment.&lt;br /&gt;
:;&#039;&#039;i&amp;lt;sub&amp;gt;1&amp;lt;/sub&amp;gt;&#039;&#039;/&#039;&#039;i&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;&#039;&#039;: Numbers of two peaks that relate the two atoms of the present assignment through a third atom.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;/&#039;&#039;r&#039;&#039;: Peak with number &#039;&#039;i&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;/&#039;&#039;i&#039;&#039;:	Peak with number &#039;&#039;i&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;~i&#039;&#039;: The peak with number &#039;&#039;i&#039;&#039; connects two atoms that are covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
&lt;br /&gt;
:For reasons of space, only the first few contributions are printed. An ellipsis “...” followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted assignments (marked by ‘+’ in lines 3–6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; parameter is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7619</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7619"/>
		<updated>2010-01-12T10:28:29Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below the &amp;lt;quality&amp;gt; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
- Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
- First atom, identified by its name, residue name, and residue number&lt;br /&gt;
- Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
- Second atom, identified by its name, residue name and number&lt;br /&gt;
- Decision on assignment possibility:&lt;br /&gt;
: &#039;OK&#039;, good assignment with probability above the &amp;lt;probability&amp;gt; cutoff&lt;br /&gt;
: &#039;far&#039;, structure based probability too low&lt;br /&gt;
: &#039;lone&#039;, network anchoring based probability too low&lt;br /&gt;
: &#039;poor&#039;, individual probabilities ok but overall probability too low&lt;br /&gt;
- Overall probability for the assignment possibility (%)&lt;br /&gt;
- Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
- Probability for agreement with input structure bundle (%)&lt;br /&gt;
- Probability derived from network anchoring (%)&lt;br /&gt;
- Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
- Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &amp;lt;real&amp;gt;: covalently constrained distance shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;integer&amp;gt;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;integer&amp;gt;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;real&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;real&amp;gt;/&amp;lt;integer&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; ~&amp;lt;integer&amp;gt;: The peak with number &amp;lt;integer&amp;gt; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &amp;lt;violation&amp;gt; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The contents of the assignment report is as follows:&lt;br /&gt;
&lt;br /&gt;
Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0...1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
Lines 3–6: Information about individual assignment possibilities: &lt;br /&gt;
&lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK : Good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff.&lt;br /&gt;
:; far : Structure based probability too low.&lt;br /&gt;
:; lone : Network anchoring based probability too low.&lt;br /&gt;
:; poor : Individual probabilities ok but overall probability too low.&lt;br /&gt;
&lt;br /&gt;
:Note that an assignment with “&#039;&#039;&#039;OK&#039;&#039;&#039;” is not necessarily used when forming a distance restraint from the peak. Even individually good assignments may be discarded because the overall quality of the peak assignments is too low, or because there exist other, much better assignments for the peak. &lt;br /&gt;
* Overall probability for the assignment possibility (%).&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%).&lt;br /&gt;
* Probability for agreement with input structure bundle (%).&lt;br /&gt;
* Probability derived from network anchoring (%).&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Å).&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;: Covalently constrained distance shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;: Peak number of a (symmetrically related) peak with the same assignment.&lt;br /&gt;
:;&#039;&#039;i&amp;lt;sub&amp;gt;1&amp;lt;/sub&amp;gt;&#039;&#039;/&#039;&#039;i&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;&#039;&#039;: Numbers of two peaks that relate the two atoms of the present assignment through a third atom.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;/&#039;&#039;r&#039;&#039;: Peak with number &#039;&#039;i&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;/&#039;&#039;i&#039;&#039;:	Peak with number &#039;&#039;i&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;~i&#039;&#039;: The peak with number &#039;&#039;i&#039;&#039; connects two atoms that are covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
&lt;br /&gt;
:For reasons of space, only the first few contributions are printed. An ellipsis “...” followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted assignments (marked by ‘+’ in lines 3–6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; parameter is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7618</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7618"/>
		<updated>2010-01-12T10:27:57Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below&lt;br /&gt;
 the &amp;lt;quality&amp;gt; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
- Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
- First atom, identified by its name, residue name, and residue number&lt;br /&gt;
- Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
- Second atom, identified by its name, residue name and number&lt;br /&gt;
- Decision on assignment possibility:&lt;br /&gt;
: &#039;OK&#039;, good assignment with probability above the &amp;lt;probability&amp;gt; cutoff&lt;br /&gt;
: &#039;far&#039;, structure based probability too low&lt;br /&gt;
: &#039;lone&#039;, network anchoring based probability too low&lt;br /&gt;
: &#039;poor&#039;, individual probabilities ok but overall probability too low&lt;br /&gt;
- Overall probability for the assignment possibility (%)&lt;br /&gt;
- Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
- Probability for agreement with input structure bundle (%)&lt;br /&gt;
- Probability derived from network anchoring (%)&lt;br /&gt;
- Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
- Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &amp;lt;real&amp;gt;: covalently constrained distance shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;integer&amp;gt;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;integer&amp;gt;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;real&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;real&amp;gt;/&amp;lt;integer&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; ~&amp;lt;integer&amp;gt;: The peak with number &amp;lt;integer&amp;gt; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &amp;lt;violation&amp;gt; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The contents of the assignment report is as follows:&lt;br /&gt;
&lt;br /&gt;
Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0...1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
Lines 3–6: Information about individual assignment possibilities: &lt;br /&gt;
&lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK : Good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff.&lt;br /&gt;
:; far : Structure based probability too low.&lt;br /&gt;
:; lone : Network anchoring based probability too low.&lt;br /&gt;
:; poor : Individual probabilities ok but overall probability too low.&lt;br /&gt;
&lt;br /&gt;
:Note that an assignment with “&#039;&#039;&#039;OK&#039;&#039;&#039;” is not necessarily used when forming a distance restraint from the peak. Even individually good assignments may be discarded because the overall quality of the peak assignments is too low, or because there exist other, much better assignments for the peak. &lt;br /&gt;
* Overall probability for the assignment possibility (%).&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%).&lt;br /&gt;
* Probability for agreement with input structure bundle (%).&lt;br /&gt;
* Probability derived from network anchoring (%).&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Å).&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;: Covalently constrained distance shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;: Peak number of a (symmetrically related) peak with the same assignment.&lt;br /&gt;
:;&#039;&#039;i&amp;lt;sub&amp;gt;1&amp;lt;/sub&amp;gt;&#039;&#039;/&#039;&#039;i&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;&#039;&#039;: Numbers of two peaks that relate the two atoms of the present assignment through a third atom.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;/&#039;&#039;r&#039;&#039;: Peak with number &#039;&#039;i&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;/&#039;&#039;i&#039;&#039;:	Peak with number &#039;&#039;i&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;~i&#039;&#039;: The peak with number &#039;&#039;i&#039;&#039; connects two atoms that are covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
&lt;br /&gt;
:For reasons of space, only the first few contributions are printed. An ellipsis “...” followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted assignments (marked by ‘+’ in lines 3–6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; parameter is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7616</id>
		<title>CYANA Command: assign</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Command:_assign&amp;diff=7616"/>
		<updated>2010-01-12T10:27:05Z</updated>

		<summary type="html">&lt;p&gt;Miki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; alignfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; matchfactor=&amp;lt;real&amp;gt;             (default: 0.5)&lt;br /&gt;
; violation=&amp;lt;real&amp;gt;               (default: -1.0)&lt;br /&gt;
; probability=&amp;lt;real&amp;gt;             (default: 0.2)&lt;br /&gt;
; quality=&amp;lt;real&amp;gt;                 (default: 0.5)&lt;br /&gt;
; elasticity=&amp;lt;real range&amp;gt;        (default: 1.0..1.0)&lt;br /&gt;
; confidence=&amp;lt;real&amp;gt;              (default: 1.0)&lt;br /&gt;
; supportweight=&amp;lt;real&amp;gt;           (default: 1.0)&lt;br /&gt;
; pathlength=&amp;lt;integer&amp;gt;           (default: 3)&lt;br /&gt;
; prefer=&amp;lt;integer&amp;gt;               (default: 999999)&lt;br /&gt;
; interrange=&amp;lt;integer range&amp;gt;     (default: 0..)&lt;br /&gt;
; unassigned=&amp;lt;real&amp;gt;              (default: 0.1)&lt;br /&gt;
; noartifact=&amp;lt;string&amp;gt;            (default: none)&lt;br /&gt;
; short&lt;br /&gt;
; nearest                            &lt;br /&gt;
; changevol&lt;br /&gt;
         &lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
The &#039;assign&#039; command performs automated assignment of the NOESY cross peaks on the basis of the given chemical shifts, knowledge of&lt;br /&gt;
covalently constrained short distances, and the selected 3D conformers, if available. The &#039;assign&#039; command is used in the &#039;noeassign&#039; macro&lt;br /&gt;
to implement a combined automated NOESY assignment and structure calculation strategy.&lt;br /&gt;
&lt;br /&gt;
=== Input data ===&lt;br /&gt;
&lt;br /&gt;
Required input data consists of unassigned (or assigned) NOESY peaks from one or several peak lists, and one or several chemical&lt;br /&gt;
shift lists.  Optional input data comprises a group of selected conformers and a list of covalently constrained short distances. To&lt;br /&gt;
each input peak an upper distance bound must have been attributed, for instance using the &#039;peaks simplecal&#039; command or the &#039;calibration&#039;&lt;br /&gt;
macro that convert peak intensitites or volumes into distance bounds.&lt;br /&gt;
&lt;br /&gt;
=== Output data ===&lt;br /&gt;
&lt;br /&gt;
Output data comprises assignments made by the &#039;assign&#039; command for the peaks that were NOT selected in the input peak lists, as well as a&lt;br /&gt;
report including details on the assignment of each individual peak and a summary table. Peaks that were selected on input are not modified. If&lt;br /&gt;
peaks are assigned and unselected on input, the report also provides a comparison between the input assignment and the new assignment made&lt;br /&gt;
by the &#039;assign&#039; command that overwrites the input assignment.&lt;br /&gt;
&lt;br /&gt;
=== Assignment strategy ===&lt;br /&gt;
&lt;br /&gt;
First all assignment possibilities of a peak are generated on the basis of the chemical shift values that match the peak position within the tolerance defined by the [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]] variable. Second, the probability for agreement with the bundle of selected conformers, if present, is computed as the fraction of the conformers in which the corresponding distance is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039;, and assignment possibilities for which the product of these two probabilities is below the required &#039;&#039;probability&#039;&#039; threshold are discarded. Third, each remaining assignment possibility is evaluated for its network anchoring, i.e., its embedding in the network formed by the assignment possibilities of all the other peaks and the covalently constrained distances. The network anchoring probability that the distance corresponding to an assignment is shorter than the upper distance bound plus the acceptable &#039;&#039;violation&#039;&#039; is computed given the assignments of the other peaks but independent from knowledge of the three-dimensional structure. Only assignment possibilities for which the product of the three probabilities is above the required &#039;&#039;probability&#039;&#039; threshold, are accepted. Next the overall quality &#039;&#039;Q&#039;&#039; of the assignment of a peak is computed from the probabilities of its individual accepted assignment possibilities. The overall quality of a peak assignment is always at least as large as the highest probability of an accepted assignment possibility. Peaks are kept assigned only if their quality exceeds the &#039;&#039;quality&#039;&#039; cutoff.&lt;br /&gt;
Example assignment report for a peak:&lt;br /&gt;
&lt;br /&gt;
=== Example assignment report for a peak ===&lt;br /&gt;
&lt;br /&gt;
  Peak 165 from c13.peaks (8.72, 4.11, 59.86 ppm; 3.08 A):&lt;br /&gt;
  2 out of 4 assignments used, quality = 0.97:&lt;br /&gt;
  * H     ILE   64 + HA    ILE   63  OK    90    99 100  91  2.1-2.3   1260=69, 63/50=24...(10)&lt;br /&gt;
    H     ILE   63 + HA    ILE   63  OK    71    71 100 100  2.8-2.8   3.0=100&lt;br /&gt;
    H     SER   43 - HA    ILE   63  far    0    95   0   -  6.4-9.0&lt;br /&gt;
    H     ALA   22 - HA    ILE   63  far    0    99   0   -  9.9-14.6&lt;br /&gt;
  Violated in 0 structures by 0.00 Å.&lt;br /&gt;
&lt;br /&gt;
- Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
- Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0..1). Quality values below&lt;br /&gt;
 the &amp;lt;quality&amp;gt; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
- Lines 3-7: Individual assignment possibilities &lt;br /&gt;
- Flag that indicates the input assignment, if present, by a &#039;*&#039; if it is among the used assignments, or by a &#039;!&#039; otherwise.&lt;br /&gt;
- First atom, identified by its name, residue name, and residue number&lt;br /&gt;
- Flag: &#039;+&#039;, used assignment; &#039;-&#039;, assignment possibility not used&lt;br /&gt;
- Second atom, identified by its name, residue name and number&lt;br /&gt;
- Decision on assignment possibility:&lt;br /&gt;
:; &#039;OK&#039;, good assignment with probability above the &amp;lt;probability&amp;gt; cutoff&lt;br /&gt;
:; &#039;far&#039;, structure based probability too low&lt;br /&gt;
:; &#039;lone&#039;, network anchoring based probability too low&lt;br /&gt;
:; &#039;poor&#039;, individual probabilities ok but overall probability too low&lt;br /&gt;
- Overall probability for the assignment possibility (%)&lt;br /&gt;
- Probability for match between peak position and chemical shifts (%)&lt;br /&gt;
- Probability for agreement with input structure bundle (%)&lt;br /&gt;
- Probability derived from network anchoring (%)&lt;br /&gt;
- Minimal and maximal distance in the selected conformers (Angstrom)&lt;br /&gt;
- Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:; &amp;lt;real&amp;gt;: covalently constrained distance shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;integer&amp;gt;: peak number of a (symmetrically related) peak with the same assignment&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;integer&amp;gt;: numbers of two peaks that relate the two atoms of the present assignment through a third atom&lt;br /&gt;
:; &amp;lt;integer&amp;gt;/&amp;lt;real&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; &amp;lt;real&amp;gt;/&amp;lt;integer&amp;gt;: peak with number &amp;lt;integer&amp;gt; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &amp;lt;real&amp;gt; A.&lt;br /&gt;
:; ~&amp;lt;integer&amp;gt;: The peak with number &amp;lt;integer&amp;gt; connects two atoms that covalently restrained to be less than x A from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
For reasons of space, only the first few contributions are printed.&lt;br /&gt;
An ellipsis &amp;quot;...&amp;quot; followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
- Line 8 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted  assignments (marked by &#039;+&#039; in lines 3-7) is violated by more than the &amp;lt;violation&amp;gt; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The contents of the assignment report is as follows:&lt;br /&gt;
&lt;br /&gt;
Line 1: Peak number, peak list, peak position, upper distance bound.&lt;br /&gt;
&lt;br /&gt;
Line 2: Number of used assignments, number of assignment possibilities, overall quality of the peak assignment (0...1). Quality values below the &#039;&#039;quality&#039;&#039; cutoff are marked as &amp;quot;low quality&amp;quot;, and the peak remains unassigned.&lt;br /&gt;
&lt;br /&gt;
Lines 3–6: Information about individual assignment possibilities: &lt;br /&gt;
&lt;br /&gt;
* Flag that indicates the input assignment, if present, by a &#039;&#039;&#039;*&#039;&#039;&#039; if it is among the used assignments, or by a &#039;&#039;&#039;!&#039;&#039;&#039; otherwise.&lt;br /&gt;
* First atom, identified by its name, residue name, and residue number&lt;br /&gt;
* Flag: &#039;&#039;&#039;+&#039;&#039;&#039;, used assignment; &#039;&#039;&#039;-&#039;&#039;&#039;, assignment possibility not used&lt;br /&gt;
* Second atom, identified by its name, residue name and number&lt;br /&gt;
* Decision on assignment possibility:&lt;br /&gt;
:; OK : Good assignment with probability above the &#039;&#039;probability&#039;&#039; cutoff.&lt;br /&gt;
:; far : Structure based probability too low.&lt;br /&gt;
:; lone : Network anchoring based probability too low.&lt;br /&gt;
:; poor : Individual probabilities ok but overall probability too low.&lt;br /&gt;
&lt;br /&gt;
:Note that an assignment with “&#039;&#039;&#039;OK&#039;&#039;&#039;” is not necessarily used when forming a distance restraint from the peak. Even individually good assignments may be discarded because the overall quality of the peak assignments is too low, or because there exist other, much better assignments for the peak. &lt;br /&gt;
* Overall probability for the assignment possibility (%).&lt;br /&gt;
* Probability for match between peak position and chemical shifts (%).&lt;br /&gt;
* Probability for agreement with input structure bundle (%).&lt;br /&gt;
* Probability derived from network anchoring (%).&lt;br /&gt;
* Minimal and maximal distance in the selected conformers (Å).&lt;br /&gt;
* Most important individual contributions to the network anchoring based probability, ordered by decreasing size. The number after the equal sign is the probability in percent for the contribution identified in front of the equal sign, as follows (only the first three possibilities appear in the example above):&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;: Covalently constrained distance shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;: Peak number of a (symmetrically related) peak with the same assignment.&lt;br /&gt;
:;&#039;&#039;i&amp;lt;sub&amp;gt;1&amp;lt;/sub&amp;gt;&#039;&#039;/&#039;&#039;i&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;&#039;&#039;: Numbers of two peaks that relate the two atoms of the present assignment through a third atom.&lt;br /&gt;
:;&#039;&#039;i&#039;&#039;/&#039;&#039;r&#039;&#039;: Peak with number &#039;&#039;i&#039;&#039; connects the first atom to a third atom whose distance from the second atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;r&#039;&#039;/&#039;&#039;i&#039;&#039;:	Peak with number &#039;&#039;i&#039;&#039; connects the second atom to a third atom whose distance from the first atom is covalently restrained to be shorter than &#039;&#039;r&#039;&#039; Å.&lt;br /&gt;
:;&#039;&#039;~i&#039;&#039;: The peak with number &#039;&#039;i&#039;&#039; connects two atoms that are covalently restrained to be less than x Å from the first and second atom of the present assignment possibility, respectively.&lt;br /&gt;
&lt;br /&gt;
:For reasons of space, only the first few contributions are printed. An ellipsis “...” followed by the total number of contributions in parenthesis indicates that not all contributions with probability greater than 1% are printed.&lt;br /&gt;
&lt;br /&gt;
Line 7 (last line): Number of conformers in which the upper distance limit of the ambiguous distance restraint formed by the accepted assignments (marked by ‘+’ in lines 3–6) is violated by more than the &#039;&#039;violation&#039;&#039; threshold, and the average size of the violation.&lt;br /&gt;
&lt;br /&gt;
=== Covalently constrained distances ===&lt;br /&gt;
&lt;br /&gt;
The covalently constrained short distances are normally taken from distance restraints with weight zero, which can be obtained, for instance, by analyzing a bundle of randomized conformers with the [[CYANA Commands: distances short|&#039;&#039;&#039;distances short&#039;&#039;&#039;]] command, as implemented in the [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]] macro. If no distance restraints with weight zero exist, the short distances are calculated internally from the select conformers (which should be randomized), if available and if &#039;&#039;violation&#039;&#039; parameter is negative, or by an analytical calculation otherwise.&lt;br /&gt;
&lt;br /&gt;
=== Elasticity of upper distance bounds ===&lt;br /&gt;
&lt;br /&gt;
When searching for peak assignments the algorithm can adapt individual upper distance bounds in the input peak lists by a factor within the allowed &#039;&#039;elasticity&#039;&#039; range. An individual upper bound can be increased if a slight violation of the original upper distance bound can be avoided by the increased distance limit in at least 80% of the conformers. An individual upper bound can be decreased if the actual distances in the input conformers are consistently shorter than the upper distance bound. By default, there is no “elasticity” of the upper distance bounds, i.e. the input distance limits are used without change.  If an upper distance is changed, its modified value is indicated in the first line of the report on the assignment of the peak. The additional option &#039;&#039;&#039;changevol&#039;&#039;&#039; can be used to correct peak volumes according to the internal change of the corresponding upper distance bound using an inverse sixth power relationship.&lt;br /&gt;
&lt;br /&gt;
=== Additional control parameters ===&lt;br /&gt;
&lt;br /&gt;
The probability for the chemical shift matching is calculated using the tolerance values multiplied by &#039;&#039;matchfactor&#039;&#039;. A smaller &#039;&#039;matchfactor&#039;&#039; implies a higher weight for good agreement between the peak coordinates and the chemical shifts. The mutual alignment of peaks is controlled by the variable &#039;&#039;&#039;tolerance&#039;&#039;&#039;, and the probability for network anchoring is calculated using the tolerance values multiplied by &#039;&#039;alignfactor&#039;&#039;. A smaller &#039;&#039;alignfactor&#039;&#039; implies a higher weight for good mutual alignment between peaks with assignment possibilities to the same atom(s). When calculating the network anchoring probability of a given peak assignment, the probabilities of other aligned peaks may be scaled by a &#039;&#039;confidence&#039;&#039; factor between 0 and 1. Chemical shift assignments with an attached chemical shift error larger than the &#039;&#039;unassigned&#039;&#039; cutoff are treated as &amp;quot;unassigned&amp;quot; when determining the initial assignment possibilities of peaks: Only one of the two atoms of an assignment may be “unassigned”, and, if in addition the &#039;short&#039; option is set, only short-range assignments for covalently constrained distances are considered.&lt;br /&gt;
&lt;br /&gt;
=== Symmetric homodimers ===&lt;br /&gt;
&lt;br /&gt;
The &#039;&#039;&#039;assign&#039;&#039;&#039; command provides special features for symmetric homodimers that can be defined with the [[CYANA Commands: molecules define|&#039;&#039;&#039;molecules define&#039;&#039;&#039;]] command. In the case of a homodimer, only assignments with the first atom in the first monomer are made. The corresponding symmetric distance restraint can be added afterwards with the [[CYANA Commands: molecules symmetrize|&#039;&#039;&#039;molecules symmetrize&#039;&#039;&#039;]] command. Homodimer assignments are restricted to be only intramolecular or only intermolecular for peaks with (XEASY) color codes 8 or 9, respectively. Furthermore, intermolecular homodimer assignments between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; are considered only if |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| is within the &#039;&#039;interrange&#039;&#039;. Intermolecular assignments of a peak are also excluded if the peak has at least one intramolecular assignment between residues &#039;&#039;i&#039;&#039; and &#039;&#039;j&#039;&#039; with |&#039;&#039;i&#039;&#039; - &#039;&#039;j&#039;&#039;| smaller than the parameter &#039;&#039;prefer&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== See also ==&lt;br /&gt;
&lt;br /&gt;
* [[CYANA Macro: noeassign|&#039;&#039;&#039;noeassign&#039;&#039;&#039;]]&lt;br /&gt;
* [[CYANA Variables: tolerance|&#039;&#039;&#039;tolerance&#039;&#039;&#039;]]&lt;/div&gt;</summary>
		<author><name>Miki</name></author>
	</entry>
</feed>