<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://cyana.org/w/index.php?action=history&amp;feed=atom&amp;title=CYANA_Macro%3A_overview</id>
	<title>CYANA Macro: overview - Revision history</title>
	<link rel="self" type="application/atom+xml" href="https://cyana.org/w/index.php?action=history&amp;feed=atom&amp;title=CYANA_Macro%3A_overview"/>
	<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;action=history"/>
	<updated>2026-06-15T12:38:08Z</updated>
	<subtitle>Revision history for this page on the wiki</subtitle>
	<generator>MediaWiki 1.45.1</generator>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7846&amp;oldid=prev</id>
		<title>Guentert at 14:05, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7846&amp;oldid=prev"/>
		<updated>2011-07-31T14:05:05Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 16:05, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l16&quot;&gt;Line 16:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 16:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;== Description ==&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;== Description ==&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Summarizes the results of a structure calculation. The summary is either stored in an overview file &lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&#039;&#039;&lt;/del&gt;name&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&#039;&#039;.&lt;/del&gt;&#039;&#039;&#039;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;ovw&lt;/del&gt;&#039;&#039;&#039;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &#039;&#039;structures&#039;&#039; with the lowest target function values are analyzed and, if one or several of the options &#039;&#039;&#039;ang, cor&#039;&#039;&#039; or &#039;&#039;&#039;pdb&#039;&#039;&#039; are given, saved in an angle file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;ang&#039;&#039;&#039;, a DG format coordinate file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;cor&#039;&#039;&#039;, or a PDB coordinate file, &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;pdb&#039;&#039;&#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Summarizes the results of a structure calculation. The summary is either stored in an overview file &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;with the &lt;/ins&gt;name &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;given by the &lt;/ins&gt;&#039;&#039;&#039;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;file&lt;/ins&gt;&#039;&#039;&#039; &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;parameter&lt;/ins&gt;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &#039;&#039;structures&#039;&#039; with the lowest target function values are analyzed and, if one or several of the options &#039;&#039;&#039;ang, cor&#039;&#039;&#039; or &#039;&#039;&#039;pdb&#039;&#039;&#039; are given, saved in an angle file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;ang&#039;&#039;&#039;, a DG format coordinate file &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;cor&#039;&#039;&#039;, or a PDB coordinate file, &#039;&#039;name&#039;&#039;.&#039;&#039;&#039;pdb&#039;&#039;&#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The summary starts with a table of the target function values and restraint violation statistics:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The summary starts with a table of the target function values and restraint violation statistics:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7836&amp;oldid=prev</id>
		<title>Guentert at 12:56, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7836&amp;oldid=prev"/>
		<updated>2011-07-31T12:56:41Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:56, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l88&quot;&gt;Line 88:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 88:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     20 hydrogen bonds.  &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     20 hydrogen bonds.  &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&#039;&#039;&#039;structures hbonds&#039;&#039;&#039;]] command is reported in the column labeled “&#039;&#039;&#039;#&#039;&#039;&#039;”, and the corresponding structures are identified by “&#039;&#039;&#039;+&#039;&#039;&#039;” signs.  &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&#039;&#039;&#039;structures hbonds&#039;&#039;&#039;]] command is reported in the column labeled “&#039;&#039;&#039;#&#039;&#039;&#039;”, and the corresponding structures are identified by “&#039;&#039;&#039;+&#039;&#039;&#039;” signs&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;. This table is also produced if the option &#039;&#039;&#039;details&#039;&#039;&#039; is set (see below). In this case the number of structures in which a hydrogen bond must be present in order to be reported defaults to the value of the parameter &#039;&#039;&#039;significant&#039;&#039;&#039;, or, if not given, to 1/3 of the structures&lt;/ins&gt;.  &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;At the end of the overview RMSD values for the given residue &amp;#039;&amp;#039;range&amp;#039;&amp;#039; are given:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;At the end of the overview RMSD values for the given residue &amp;#039;&amp;#039;range&amp;#039;&amp;#039; are given:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7835&amp;oldid=prev</id>
		<title>Guentert at 12:52, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7835&amp;oldid=prev"/>
		<updated>2011-07-31T12:52:38Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:52, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l53&quot;&gt;Line 53:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 53:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Restraints that are violated by more than the corresponding cutoff value in a &#039;&#039;significant&#039;&#039; number of structures, as defined by the &#039;&#039;&#039;significant&#039;&#039;&#039; parameter, are reported:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Restraints that are violated by more than the corresponding cutoff value in a &#039;&#039;significant&#039;&#039; number of structures, as defined by the &#039;&#039;&#039;significant&#039;&#039;&#039; parameter &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;(default: 1/3 of the structures)&lt;/ins&gt;, are reported:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Constraints violated in 6 or more structures:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Constraints violated in 6 or more structures:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7834&amp;oldid=prev</id>
		<title>Guentert at 12:51, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7834&amp;oldid=prev"/>
		<updated>2011-07-31T12:51:24Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:51, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l20&quot;&gt;Line 20:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 20:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The summary starts with a table of the target function values and restraint violation statistics:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The summary starts with a table of the target function values and restraint violation statistics:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;      &lt;/del&gt;Structural statistics:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;    &lt;/ins&gt;Structural statistics:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;   &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;   &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     str   target     upper limits    van der Waals   torsion angles&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     str   target     upper limits    van der Waals   torsion angles&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7833&amp;oldid=prev</id>
		<title>Guentert at 12:51, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7833&amp;oldid=prev"/>
		<updated>2011-07-31T12:51:03Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:51, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l17&quot;&gt;Line 17:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 17:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Summarizes the results of a structure calculation. The summary is either stored in an overview file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;ovw&amp;#039;&amp;#039;&amp;#039;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &amp;#039;&amp;#039;structures&amp;#039;&amp;#039; with the lowest target function values are analyzed and, if one or several of the options &amp;#039;&amp;#039;&amp;#039;ang, cor&amp;#039;&amp;#039;&amp;#039; or &amp;#039;&amp;#039;&amp;#039;pdb&amp;#039;&amp;#039;&amp;#039; are given, saved in an angle file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;ang&amp;#039;&amp;#039;&amp;#039;, a DG format coordinate file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;cor&amp;#039;&amp;#039;&amp;#039;, or a PDB coordinate file, &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;pdb&amp;#039;&amp;#039;&amp;#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Summarizes the results of a structure calculation. The summary is either stored in an overview file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;ovw&amp;#039;&amp;#039;&amp;#039;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &amp;#039;&amp;#039;structures&amp;#039;&amp;#039; with the lowest target function values are analyzed and, if one or several of the options &amp;#039;&amp;#039;&amp;#039;ang, cor&amp;#039;&amp;#039;&amp;#039; or &amp;#039;&amp;#039;&amp;#039;pdb&amp;#039;&amp;#039;&amp;#039; are given, saved in an angle file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;ang&amp;#039;&amp;#039;&amp;#039;, a DG format coordinate file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;cor&amp;#039;&amp;#039;&amp;#039;, or a PDB coordinate file, &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;pdb&amp;#039;&amp;#039;&amp;#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-side-deleted&quot;&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The summary starts with a table of the target function values and restraint violation statistics:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The summary starts with a table of the target function values and restraint violation statistics:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l52&quot;&gt;Line 52:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 53:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Restraints that are violated in a &#039;&#039;significant&#039;&#039; number of structures by &lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;more than &lt;/del&gt;the &lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;corresponding cutoff value &lt;/del&gt;are reported:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Restraints that are violated &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;by more than the corresponding cutoff value &lt;/ins&gt;in a &#039;&#039;significant&#039;&#039; number of structures&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;, as defined &lt;/ins&gt;by the &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&#039;&#039;&#039;significant&#039;&#039;&#039; parameter, &lt;/ins&gt;are reported:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Constraints violated in 6 or more structures:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Constraints violated in 6 or more structures:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7832&amp;oldid=prev</id>
		<title>Guentert: /* Description */</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7832&amp;oldid=prev"/>
		<updated>2011-07-31T12:46:49Z</updated>

		<summary type="html">&lt;p&gt;&lt;span class=&quot;autocomment&quot;&gt;Description&lt;/span&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:46, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l88&quot;&gt;Line 88:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 88:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&amp;#039;&amp;#039;&amp;#039;structures hbonds&amp;#039;&amp;#039;&amp;#039;]] command is reported in the column labeled “&amp;#039;&amp;#039;&amp;#039;#&amp;#039;&amp;#039;&amp;#039;”, and the corresponding structures are identified by “&amp;#039;&amp;#039;&amp;#039;+&amp;#039;&amp;#039;&amp;#039;” signs.  &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&amp;#039;&amp;#039;&amp;#039;structures hbonds&amp;#039;&amp;#039;&amp;#039;]] command is reported in the column labeled “&amp;#039;&amp;#039;&amp;#039;#&amp;#039;&amp;#039;&amp;#039;”, and the corresponding structures are identified by “&amp;#039;&amp;#039;&amp;#039;+&amp;#039;&amp;#039;&amp;#039;” signs.  &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-side-deleted&quot;&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;At the end of the overview RMSD values for the given residue &amp;#039;&amp;#039;range&amp;#039;&amp;#039; are given:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;At the end of the overview RMSD values for the given residue &amp;#039;&amp;#039;range&amp;#039;&amp;#039; are given:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     RMSDs for residues 15..84:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     RMSDs for residues 15..84:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l93&quot;&gt;Line 93:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 94:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;If the parameter &amp;#039;&amp;#039;&amp;#039;range&amp;#039;&amp;#039;&amp;#039; for residue range is absent, the range will be taken from the variable &amp;#039;&amp;#039;&amp;#039;rmsdrange&amp;#039;&amp;#039;&amp;#039;, if defined, or determined automatically by the [[CYANA Macro: overlay|&amp;#039;&amp;#039;&amp;#039;overlay&amp;#039;&amp;#039;&amp;#039;]] command otherwise. The RMSD calculation can be suppressed by setting &amp;#039;&amp;#039;&amp;#039;range=–&amp;#039;&amp;#039;&amp;#039;. The residue range used for the superposition is indicated, and RMSD values are computed for the backbone and heavy atoms with the [[CYANA Macro: rmsd|&amp;#039;&amp;#039;&amp;#039;rmsd&amp;#039;&amp;#039;&amp;#039;]] command. The average value, the standard deviation, and the minimal and maximal values of the RMSDs between the analyzed structures and their mean coordinates are calculated.  &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;If the parameter &amp;#039;&amp;#039;&amp;#039;range&amp;#039;&amp;#039;&amp;#039; for residue range is absent, the range will be taken from the variable &amp;#039;&amp;#039;&amp;#039;rmsdrange&amp;#039;&amp;#039;&amp;#039;, if defined, or determined automatically by the [[CYANA Macro: overlay|&amp;#039;&amp;#039;&amp;#039;overlay&amp;#039;&amp;#039;&amp;#039;]] command otherwise. The RMSD calculation can be suppressed by setting &amp;#039;&amp;#039;&amp;#039;range=–&amp;#039;&amp;#039;&amp;#039;. The residue range used for the superposition is indicated, and RMSD values are computed for the backbone and heavy atoms with the [[CYANA Macro: rmsd|&amp;#039;&amp;#039;&amp;#039;rmsd&amp;#039;&amp;#039;&amp;#039;]] command. The average value, the standard deviation, and the minimal and maximal values of the RMSDs between the analyzed structures and their mean coordinates are calculated.  &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-side-deleted&quot;&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;If a &amp;#039;&amp;#039;reference&amp;#039;&amp;#039; structure has been specified, then the RMSD values between the mean coordinates of the analyzed structures and the mean coordinates of the reference structure(s) are reported in two additional lines:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;If a &amp;#039;&amp;#039;reference&amp;#039;&amp;#039; structure has been specified, then the RMSD values between the mean coordinates of the analyzed structures and the mean coordinates of the reference structure(s) are reported in two additional lines:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     RMSDs for residues 15..84:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     RMSDs for residues 15..84:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7831&amp;oldid=prev</id>
		<title>Guentert: /* Description */</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7831&amp;oldid=prev"/>
		<updated>2011-07-31T12:46:00Z</updated>

		<summary type="html">&lt;p&gt;&lt;span class=&quot;autocomment&quot;&gt;Description&lt;/span&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:46, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l51&quot;&gt;Line 51:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 51:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-side-deleted&quot;&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Restraints that are violated in a &amp;#039;&amp;#039;significant&amp;#039;&amp;#039; number of structures by more than the corresponding cutoff value are reported:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Restraints that are violated in a &amp;#039;&amp;#039;significant&amp;#039;&amp;#039; number of structures by more than the corresponding cutoff value are reported:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l61&quot;&gt;Line 61:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 62:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Each line identifies a violated restraint, and gives the number of structures in which the restraint is violated by more than the aforementioned cutoff value (column labeled “&amp;#039;&amp;#039;&amp;#039;#&amp;#039;&amp;#039;&amp;#039;”), its maximal violation (column “max.”), and the structures in which the violations occur (a one-character column for each structure that is analyzed). Structures in which the restraint is violated by more than the cutoff are marked with “&amp;#039;&amp;#039;&amp;#039;+&amp;#039;&amp;#039;&amp;#039;”, or with a “*” for the structure in which the maximal violation occurs. If available, the number of the cross peak from which the restraint originated is given at the end of the line.  &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Each line identifies a violated restraint, and gives the number of structures in which the restraint is violated by more than the aforementioned cutoff value (column labeled “&amp;#039;&amp;#039;&amp;#039;#&amp;#039;&amp;#039;&amp;#039;”), its maximal violation (column “max.”), and the structures in which the violations occur (a one-character column for each structure that is analyzed). Structures in which the restraint is violated by more than the cutoff are marked with “&amp;#039;&amp;#039;&amp;#039;+&amp;#039;&amp;#039;&amp;#039;”, or with a “*” for the structure in which the maximal violation occurs. If available, the number of the cross peak from which the restraint originated is given at the end of the line.  &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-side-deleted&quot;&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;A list of the hydrogen bonds that occur in more than &amp;#039;&amp;#039;hbond&amp;#039;&amp;#039; structures is given if requested by the &amp;#039;&amp;#039;&amp;#039;hbond&amp;#039;&amp;#039;&amp;#039; parameter:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;A list of the hydrogen bonds that occur in more than &amp;#039;&amp;#039;hbond&amp;#039;&amp;#039; structures is given if requested by the &amp;#039;&amp;#039;&amp;#039;hbond&amp;#039;&amp;#039;&amp;#039; parameter:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Hydrogen bonds:                   # 1   5   10   15   20&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Hydrogen bonds:                   # 1   5   10   15   20&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7830&amp;oldid=prev</id>
		<title>Guentert at 12:44, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7830&amp;oldid=prev"/>
		<updated>2011-07-31T12:44:21Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:44, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l137&quot;&gt;Line 137:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 137:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.   &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.   &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics determined by the command [[CYANA Command: &lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;structures &lt;/del&gt;ramachandran|&#039;&#039;&#039;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;structures &lt;/del&gt;ramachandran&#039;&#039;&#039;]] are reported:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics determined by the command [[CYANA Command: &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;angles &lt;/ins&gt;ramachandran|&#039;&#039;&#039;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;angles &lt;/ins&gt;ramachandran&#039;&#039;&#039;]] are reported:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Ramachandran plot outliers:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Ramachandran plot outliers:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;                   #  1   5   10   15   20&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;                   #  1   5   10   15   20&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7829&amp;oldid=prev</id>
		<title>Guentert at 12:43, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7829&amp;oldid=prev"/>
		<updated>2011-07-31T12:43:49Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table style=&quot;background-color: #fff; color: #202122;&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr class=&quot;diff-title&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: #fff; color: #202122; text-align: center;&quot;&gt;Revision as of 14:43, 31 July 2011&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l136&quot;&gt;Line 136:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 136:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;br&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.   &lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.   &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;−&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics are reported:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt; &lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-side-deleted&quot;&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot; data-marker=&quot;+&quot;&gt;&lt;/td&gt;&lt;td style=&quot;color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics &lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;determined by the command [[CYANA Command: structures ramachandran|&#039;&#039;&#039;structures ramachandran&#039;&#039;&#039;]] &lt;/ins&gt;are reported:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Ramachandran plot outliers:&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;     Ramachandran plot outliers:&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;                   #  1   5   10   15   20&lt;/div&gt;&lt;/td&gt;&lt;td class=&quot;diff-marker&quot;&gt;&lt;/td&gt;&lt;td style=&quot;background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;                   #  1   5   10   15   20&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
	<entry>
		<id>https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7828&amp;oldid=prev</id>
		<title>Guentert at 12:40, 31 July 2011</title>
		<link rel="alternate" type="text/html" href="https://cyana.org/w/index.php?title=CYANA_Macro:_overview&amp;diff=7828&amp;oldid=prev"/>
		<updated>2011-07-31T12:40:15Z</updated>

		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;p&gt;&lt;b&gt;New page&lt;/b&gt;&lt;/p&gt;&lt;div&gt;== Parameters ==&lt;br /&gt;
&lt;br /&gt;
; file=&amp;#039;&amp;#039;filename&amp;#039;&amp;#039;.ovw: (default: &amp;#039;&amp;#039;blank&amp;#039;&amp;#039;)&lt;br /&gt;
; structures=&amp;#039;&amp;#039;integer&amp;#039;&amp;#039;: (default: 0)&lt;br /&gt;
; range=&amp;#039;&amp;#039;string&amp;#039;&amp;#039;: (default: &amp;#039;&amp;#039;none&amp;#039;&amp;#039;)&lt;br /&gt;
; reference=&amp;#039;&amp;#039;string&amp;#039;&amp;#039;: (default: &amp;#039;&amp;#039;blank&amp;#039;&amp;#039;)&lt;br /&gt;
; significant=&amp;#039;&amp;#039;integer&amp;#039;&amp;#039;: (default: -1)&lt;br /&gt;
; hbond=&amp;#039;&amp;#039;integer&amp;#039;&amp;#039;: (default: -1)&lt;br /&gt;
; mode=sum|average|rms: (default: rms)&lt;br /&gt;
; ang&lt;br /&gt;
; cor&lt;br /&gt;
; pdb&lt;br /&gt;
; mean&lt;br /&gt;
; details&lt;br /&gt;
&lt;br /&gt;
== Description ==&lt;br /&gt;
&lt;br /&gt;
Summarizes the results of a structure calculation. The summary is either stored in an overview file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;ovw&amp;#039;&amp;#039;&amp;#039;, or shown on standard output. The selected structures are sorted with regard to their target function value and the given number of &amp;#039;&amp;#039;structures&amp;#039;&amp;#039; with the lowest target function values are analyzed and, if one or several of the options &amp;#039;&amp;#039;&amp;#039;ang, cor&amp;#039;&amp;#039;&amp;#039; or &amp;#039;&amp;#039;&amp;#039;pdb&amp;#039;&amp;#039;&amp;#039; are given, saved in an angle file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;ang&amp;#039;&amp;#039;&amp;#039;, a DG format coordinate file &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;cor&amp;#039;&amp;#039;&amp;#039;, or a PDB coordinate file, &amp;#039;&amp;#039;name&amp;#039;&amp;#039;.&amp;#039;&amp;#039;&amp;#039;pdb&amp;#039;&amp;#039;&amp;#039;, respectively. The remaining structures are permanently discarded. The target function values are recalculated on the basis of the current restraints, weights and other parameters.&lt;br /&gt;
The summary starts with a table of the target function values and restraint violation statistics:&lt;br /&gt;
&lt;br /&gt;
      Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals   torsion angles&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     0.20   1 0.0035  0.20   0    1.4  0.16   0 0.1205  1.22&lt;br /&gt;
      2     0.22   1 0.0036  0.19   0    1.5  0.17   0 0.1499  1.52&lt;br /&gt;
      3     0.22   2 0.0039  0.19   0    1.4  0.16   0 0.1597  1.64&lt;br /&gt;
      4     0.22   1 0.0032  0.18   0    1.5  0.16   0 0.1393  1.43&lt;br /&gt;
      5     0.22   1 0.0037  0.20   0    1.5  0.16   0 0.1751  1.79&lt;br /&gt;
      6     0.22   1 0.0036  0.19   0    1.6  0.16   0 0.1368  1.39&lt;br /&gt;
      7     0.22   2 0.0041  0.21   0    1.4  0.16   0 0.1730  1.79&lt;br /&gt;
      8     0.23   1 0.0034  0.18   0    1.6  0.16   0 0.1116  1.12&lt;br /&gt;
      9     0.24   1 0.0037  0.19   0    1.6  0.17   0 0.1647  1.69&lt;br /&gt;
     10     0.24   2 0.0039  0.18   0    1.6  0.16   0 0.1312  1.31&lt;br /&gt;
     11     0.24   2 0.0038  0.18   0    1.7  0.16   0 0.1127  1.13&lt;br /&gt;
     12     0.24   2 0.0041  0.18   0    1.6  0.16   0 0.1322  1.26&lt;br /&gt;
     13     0.25   2 0.0038  0.18   0    1.6  0.16   0 0.1475  1.49&lt;br /&gt;
     14     0.25   2 0.0042  0.21   0    1.6  0.17   0 0.1497  1.45&lt;br /&gt;
     15     0.25   1 0.0037  0.20   0    1.8  0.16   0 0.1287  1.25&lt;br /&gt;
     16     0.25   1 0.0033  0.18   0    1.8  0.16   0 0.1347  1.37&lt;br /&gt;
     17     0.26   1 0.0035  0.18   0    1.8  0.16   0 0.1568  1.57&lt;br /&gt;
     18     0.26   2 0.0039  0.19   0    1.8  0.16   0 0.1308  1.32&lt;br /&gt;
     19     0.26   1 0.0040  0.20   0    1.9  0.16   0 0.1240  1.22&lt;br /&gt;
     20     0.26   1 0.0033  0.18   0    1.7  0.16   0 0.1678  1.46&lt;br /&gt;
 &lt;br /&gt;
    Ave     0.24   1 0.0037  0.19   0    1.6  0.16   0 0.1423  1.42&lt;br /&gt;
    +/- 1.71E-02   0 0.0003  0.01   0    0.1  0.00   0 0.0188  0.20&lt;br /&gt;
    Min     0.20   1 0.0032  0.18   0    1.4  0.16   0 0.1116  1.12&lt;br /&gt;
    Max     0.26   2 0.0042  0.21   0    1.9  0.17   0 0.1751  1.79&lt;br /&gt;
    Cut                      0.10             0.20             5.00&lt;br /&gt;
&lt;br /&gt;
This table has one row for each structure, containing the rank of the structure sorted by target function value, the target function value, and three columns for each type of conformational restraints that is present. For each restraint type, the first column gives the number of restraints that are violated by more than the cutoff value given in the last row (“Cut”), the root-mean-square  (RMS) violation calculated over all, violated and fulfilled, restraints of this type, and the maximal violation. Depending on the &amp;#039;&amp;#039;mode&amp;#039;&amp;#039;, it is possible to report the sum of the violations or the average violations instead of the RMS violation. The five bottom lines of the Table give the average value, the standard deviation, the minimum value, and the maximum value of the corresponding quantity over the individual structures, as well as the cutoff value for significant violations.&lt;br /&gt;
Restraints that are violated in a &amp;#039;&amp;#039;significant&amp;#039;&amp;#039; number of structures by more than the corresponding cutoff value are reported:&lt;br /&gt;
&lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper H     PHE   64 - HB2   GLU   65   5.50  11   0.11   0.21  +++ ++* +    +++  +   peak 3766&lt;br /&gt;
    Upper H     PHE   64 - HB3   GLU   65   5.50   9   0.08   0.19     +   + ++++   +* +  peak 3766&lt;br /&gt;
    2 violated distance constraints.&lt;br /&gt;
    0 violated angle constraints.&lt;br /&gt;
&lt;br /&gt;
Each line identifies a violated restraint, and gives the number of structures in which the restraint is violated by more than the aforementioned cutoff value (column labeled “&amp;#039;&amp;#039;&amp;#039;#&amp;#039;&amp;#039;&amp;#039;”), its maximal violation (column “max.”), and the structures in which the violations occur (a one-character column for each structure that is analyzed). Structures in which the restraint is violated by more than the cutoff are marked with “&amp;#039;&amp;#039;&amp;#039;+&amp;#039;&amp;#039;&amp;#039;”, or with a “*” for the structure in which the maximal violation occurs. If available, the number of the cross peak from which the restraint originated is given at the end of the line. &lt;br /&gt;
A list of the hydrogen bonds that occur in more than &amp;#039;&amp;#039;hbond&amp;#039;&amp;#039; structures is given if requested by the &amp;#039;&amp;#039;&amp;#039;hbond&amp;#039;&amp;#039;&amp;#039; parameter:&lt;br /&gt;
    Hydrogen bonds:                   # 1   5   10   15   20&lt;br /&gt;
    H     LYS   23 - O     SER   19  20 ++++++++++++++++++++&lt;br /&gt;
    H     ARG   24 - O     TYR   20  19 ++++++++++++ +++++++&lt;br /&gt;
    HE21  GLN   25 - O     GLN   25  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   26 - O     GLU   22  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   28 - O     ARG   24  20 ++++++++++++++++++++&lt;br /&gt;
    H     ASN   31 - O     SER   27  20 ++++++++++++++++++++&lt;br /&gt;
    H     ARG   40 - O     LYS   37  15 +++ + +++++++  +++ +&lt;br /&gt;
    H     VAL   41 - O     LEU   38  20 ++++++++++++++++++++&lt;br /&gt;
    H     ILE   44 - O     VAL   41  18 ++++ ++++++++++ ++++&lt;br /&gt;
    H     ARG   48 - O     ILE   45  16 ++   ++++++++ ++++++&lt;br /&gt;
    HH21  ARG   48 - OG    SER   47  15 ++  + +++++ ++++ +++&lt;br /&gt;
    H     GLU   49 - O     ILE   45  20 ++++++++++++++++++++&lt;br /&gt;
    H     LEU   52 - O     GLU   49  20 ++++++++++++++++++++&lt;br /&gt;
    H     LYS   53 - O     GLU   49  19 ++++++ +++++++++++++&lt;br /&gt;
    H     SER   55 - O     LYS   53  15 +++++ + ++++++ +  ++&lt;br /&gt;
    H     GLU   76 - O     LEU   72  20 ++++++++++++++++++++&lt;br /&gt;
    H     VAL   79 - O     LEU   75  17 ++++++++++++ + ++++&lt;br /&gt;
    H     THR   80 - O     GLU   76  20 ++++++++++++++++++++&lt;br /&gt;
    H     CYS   82 - O     TYR   78  15 +++++++++++ +  + ++&lt;br /&gt;
    H     LEU   83 - O     VAL   79  18 +++++ ++++++++++++ +&lt;br /&gt;
    20 hydrogen bonds. &lt;br /&gt;
&lt;br /&gt;
The number of structures in which a particular H-bond is found by the [[CYANA Command: structures hbonds|&amp;#039;&amp;#039;&amp;#039;structures hbonds&amp;#039;&amp;#039;&amp;#039;]] command is reported in the column labeled “&amp;#039;&amp;#039;&amp;#039;#&amp;#039;&amp;#039;&amp;#039;”, and the corresponding structures are identified by “&amp;#039;&amp;#039;&amp;#039;+&amp;#039;&amp;#039;&amp;#039;” signs. &lt;br /&gt;
At the end of the overview RMSD values for the given residue &amp;#039;&amp;#039;range&amp;#039;&amp;#039; are given:&lt;br /&gt;
    RMSDs for residues 15..84:&lt;br /&gt;
    Average backbone RMSD to mean   :    0.37 +/- 0.08 A (0.22..0.53 A; 20 structures)&lt;br /&gt;
    Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;br /&gt;
If the parameter &amp;#039;&amp;#039;&amp;#039;range&amp;#039;&amp;#039;&amp;#039; for residue range is absent, the range will be taken from the variable &amp;#039;&amp;#039;&amp;#039;rmsdrange&amp;#039;&amp;#039;&amp;#039;, if defined, or determined automatically by the [[CYANA Macro: overlay|&amp;#039;&amp;#039;&amp;#039;overlay&amp;#039;&amp;#039;&amp;#039;]] command otherwise. The RMSD calculation can be suppressed by setting &amp;#039;&amp;#039;&amp;#039;range=–&amp;#039;&amp;#039;&amp;#039;. The residue range used for the superposition is indicated, and RMSD values are computed for the backbone and heavy atoms with the [[CYANA Macro: rmsd|&amp;#039;&amp;#039;&amp;#039;rmsd&amp;#039;&amp;#039;&amp;#039;]] command. The average value, the standard deviation, and the minimal and maximal values of the RMSDs between the analyzed structures and their mean coordinates are calculated. &lt;br /&gt;
If a &amp;#039;&amp;#039;reference&amp;#039;&amp;#039; structure has been specified, then the RMSD values between the mean coordinates of the analyzed structures and the mean coordinates of the reference structure(s) are reported in two additional lines:&lt;br /&gt;
    RMSDs for residues 15..84:&lt;br /&gt;
    Average backbone RMSD to mean   :    0.37 +/- 0.08 A (0.22..0.53 A; 20 structures)&lt;br /&gt;
    Average heavy atom RMSD to mean :    0.80 +/- 0.09 A (0.66..1.00 A; 20 structures)&lt;br /&gt;
    Backbone RMSD to reference      :    0.89 A (210 atoms)&lt;br /&gt;
    Heavy atom RMSD to reference    :    1.17 A (571 atoms)&lt;br /&gt;
The number of corresponding atoms that have been superimposed in the two structures to calculate the RMSD values to the reference structure are given in parenthesis. RMSD values are computed with the [[CYANA Macro: rmsd|&amp;#039;&amp;#039;&amp;#039;rmsd&amp;#039;&amp;#039;&amp;#039;]] command.&lt;br /&gt;
&lt;br /&gt;
Additional output can be obtained by setting the option &amp;#039;&amp;#039;&amp;#039;details&amp;#039;&amp;#039;&amp;#039;. This includes first the consensus secondary structure determined by the DSSP algorithm (Kabsch &amp;amp; Sander, 1983), implemented in the command [[CYANA Command: structures secondary|&amp;#039;&amp;#039;&amp;#039;structures secondary&amp;#039;&amp;#039;&amp;#039;]]:&lt;br /&gt;
    Consensus secondary structure in 20 or more conformers:&lt;br /&gt;
               1   5   10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   85&lt;br /&gt;
    4-turn   :                   &amp;gt;&amp;gt;&amp;gt;&amp;gt;XXXXXX&amp;lt;&amp;lt;&amp;lt;&amp;lt; &amp;gt;44&amp;gt;X4&amp;gt;XX&amp;gt;&amp;lt;X&amp;lt;&amp;lt;4X444&amp;lt;  &amp;gt;444&amp;lt;  &amp;gt;444&amp;lt;&amp;gt;44&amp;gt;X&amp;gt;4XX&amp;lt;&amp;gt;X&amp;lt;4&amp;lt;&amp;lt;&lt;br /&gt;
    3-turn   :                        &amp;gt;33&amp;lt;         &amp;gt;33&amp;lt;    &amp;gt;33&amp;lt;&amp;gt;33&amp;lt;&lt;br /&gt;
    Summary  :                    HHHHHHHHHHHH      HHHHHHHHH                         HHHHHHHHHHH&lt;br /&gt;
    Sequence : GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRK&lt;br /&gt;
               1   5   10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   85&lt;br /&gt;
A list of the torsion angles with a “split” distribution of values, determined by the command [[CYANA Command: angles split|&amp;#039;&amp;#039;&amp;#039;angles split&amp;#039;&amp;#039;&amp;#039;]], follows: &lt;br /&gt;
    Split angles:    mean1  mean2    dev   # 1   5   10   15   20&lt;br /&gt;
    PSI   LYS   14   169.8  -61.6   11.0   4   +   +  +     +&lt;br /&gt;
    CHI1  CYS   15    51.6  -65.4    9.5  10  ++ +   +   + + ++++&lt;br /&gt;
    PSI   PRO   17   124.5  173.6    0.6   6  ++     +      +  ++&lt;br /&gt;
    PHI   MET   18   -87.4 -132.4    3.5   6  ++     +      +  ++&lt;br /&gt;
    CHI1  SER   19   -53.9 -168.9   11.6   8  ++      +++  ++   +&lt;br /&gt;
    CHI2  GLU   22   -75.8 -166.1    9.1   4        +  + +   +&lt;br /&gt;
    CHI2  LYS   32   -86.5 -176.9    3.7   2          +         +&lt;br /&gt;
    CHI1  GLU   36    60.4  169.0    3.3   4        +      + +  +&lt;br /&gt;
    CHI1  VAL   42    70.4 -174.5    2.6   7    + +  +   +++    +&lt;br /&gt;
    CHI3  GLN   46   -23.5   21.6    4.4   4      + +      +  +&lt;br /&gt;
    CHI2  ARG   48   -68.8 -124.9    3.2   1            +&lt;br /&gt;
    CHI1  LYS   53  -175.2   74.4    7.4   5 ++    ++     +&lt;br /&gt;
    PSI   LYS   53   -30.8  159.5    0.6   4      + +      +  +&lt;br /&gt;
    PHI   ASN   54   -89.1   62.6    2.1   4      + +      +  +&lt;br /&gt;
    CHI1  GLU   61   -74.7   59.2    9.7   7 + +  +  +   +  ++&lt;br /&gt;
    CHI1  GLU   65    83.2  -32.8    1.2   9        ++++ ++ + + +&lt;br /&gt;
    CHI1  THR   66    62.3 -175.9    8.8   9  + ++        + +++++&lt;br /&gt;
    CHI2  LYS   68   168.0   75.9   10.4   7          ++ ++   +++&lt;br /&gt;
    CHI1  ARG   73   -93.1 -159.1    8.2  10  ++  + +++    ++  ++&lt;br /&gt;
    CHI2  ARG   73   -67.3   64.2    3.7   8  ++  +  ++    +   ++&lt;br /&gt;
    CHI4  ARG   73  -179.8   76.8    9.1   6  ++    ++   +     +&lt;br /&gt;
    CHI1  SER   81   -77.2  171.3   11.2   9 + ++ + +  +++    +&lt;br /&gt;
    CHI1  CYS   82  -172.8  -78.5   11.7   9 +      ++  + + ++ ++&lt;br /&gt;
    PSI   LYS   88    71.3  159.9    1.4   6     ++ + +  +    +&lt;br /&gt;
    24 split dihedral angle distributions.&lt;br /&gt;
&lt;br /&gt;
These are torsion angles for which the values in the analyzed structures are clearly clustered around two or more distinct positions. Split torsion angle values typically show up as “two conformations”  in a visual representation of the 3D structure bundle, and may help to identify problems in the structure determination.  &lt;br /&gt;
Ramachandran plot outliers, i. e. amino acid residues with φ/ψ angle pairs in the generously allowed or disallowed regions of the PROCHECK Ramachandran plot (Laskowski et al., 1996) and the overall Ramachandran plot statistics are reported:&lt;br /&gt;
    Ramachandran plot outliers:&lt;br /&gt;
                  #  1   5   10   15   20&lt;br /&gt;
    LYS    88     1  ....* ... ....... ..&lt;br /&gt;
    Residues in most favored regions        :  89.1 %&lt;br /&gt;
    Residues in additionally allowed regions:  10.8 % (symbol: .)&lt;br /&gt;
    Residues in generously allowed regions  :   0.0 % (symbol: +)&lt;br /&gt;
    Residues in disallowed regions          :   0.1 % (symbol: *)&lt;/div&gt;</summary>
		<author><name>Guentert</name></author>
	</entry>
</feed>